Names & Taxonomy
- Uniprot ID:
- Q15078
- Entry Name:
- CD5R1_HUMAN
- Status:
- reviewed
- Protein Names:
- Cyclin-dependent kinase 5 activator 1 (CDK5 activator 1) (Cyclin-dependent kinase 5 regulatory subunit 1) (TPKII regulatory subunit) [Cleaved into: Cyclin-dependent kinase 5 activator 1, p35 (p35); Cyclin-dependent kinase 5 activator 1, p25 (p25) (Tau protein kinase II 23 kDa subunit) (p23)]
- Gene Names:
- CDK5R1 CDK5R NCK5A
- Gene Names Primary:
- CDK5R1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 307
- Sequence:
- MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cyclin-dependent kinase 5 activator 1, p35: Cell membrane
Function
- Function:
- p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution.
- Gene Ontology Go:
- axon
contractile fiber
cyclin-dependent protein kinase 5 holoenzyme complex
cytoplasm
cytosol
dendrite
dendritic spine
growth cone
intracellular membrane-bounded organelle
membrane
neuromuscular junction
neuronal cell body
nucleoplasm
nucleus
perinuclear region of cytoplasm
plasma membrane
postsynaptic density
cadherin binding
calcium ion binding
cyclin-dependent protein kinase 5 activator activity
cyclin-dependent protein serine/threonine kinase activity
kinase activity
protein kinase activity
protein kinase binding
protein serine/threonine kinase activator activity
axon guidance
axonal fasciculation
brain development
cell proliferation
cerebellum development
embryo development
ephrin receptor signaling pathway
G-protein coupled acetylcholine receptor signaling pathway
hippocampus development
ionotropic glutamate receptor signaling pathway
layer formation in cerebral cortex
negative regulation of axon extension
negative regulation of transcription, DNA-templated
neuron cell-cell adhesion
neuron differentiation
neuron migration
neuron projection development
peptidyl-serine phosphorylation
peptidyl-threonine phosphorylation
positive regulation of cell cycle arrest
positive regulation of neuron apoptotic process
positive regulation of protein targeting to membrane
regulation of actin cytoskeleton organization
regulation of cyclin-dependent protein serine/threonine kinase activity
regulation of dendritic spine morphogenesis
regulation of macroautophagy
regulation of microtubule cytoskeleton organization
regulation of neuron differentiation
rhythmic process
serine phosphorylation of STAT3 protein
superior olivary nucleus maturation - Gene Ontology Biological Process:
- axonal fasciculation
axon guidance
brain development
cell proliferation
cerebellum development
embryo development
ephrin receptor signaling pathway
G-protein coupled acetylcholine receptor signaling pathway
hippocampus development
ionotropic glutamate receptor signaling pathway
layer formation in cerebral cortex
negative regulation of axon extension
negative regulation of transcription, DNA-templated
neuron cell-cell adhesion
neuron differentiation
neuron migration
neuron projection development
peptidyl-serine phosphorylation
peptidyl-threonine phosphorylation
positive regulation of cell cycle arrest
positive regulation of neuron apoptotic process
positive regulation of protein targeting to membrane
regulation of actin cytoskeleton organization
regulation of cyclin-dependent protein serine/threonine kinase activity
regulation of dendritic spine morphogenesis
regulation of macroautophagy
regulation of microtubule cytoskeleton organization
regulation of neuron differentiation
rhythmic process
serine phosphorylation of STAT3 protein
superior olivary nucleus maturation - Gene Ontology Molecular Function:
- cadherin binding
calcium ion binding
cyclin-dependent protein kinase 5 activator activity
cyclin-dependent protein serine/threonine kinase activity
kinase activity
protein kinase activity
protein kinase binding
protein serine/threonine kinase activator activity - Gene Ontology Cellular Component:
- axon
contractile fiber
cyclin-dependent protein kinase 5 holoenzyme complex
cytoplasm
cytosol
dendrite
dendritic spine
growth cone
intracellular membrane-bounded organelle
membrane
neuromuscular junction
neuronal cell body
nucleoplasm
nucleus
perinuclear region of cytoplasm
plasma membrane
postsynaptic density - Keywords:
- 3D-structure
Biological rhythms
Cell membrane
Complete proteome
Cytoplasm
Lipoprotein
Membrane
Myristate
Nucleus
Phosphoprotein
Reference proteome
Ubl conjugation - Interacts With:
- Q6ZMQ8-1; Q6ZMQ8-2; Q00535; Q5JR59