Names & Taxonomy
- Uniprot ID:
- Q07699
- Entry Name:
- SCN1B_HUMAN
- Status:
- reviewed
- Protein Names:
- Sodium channel subunit beta-1
- Gene Names:
- SCN1B
- Gene Names Primary:
- SCN1B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 218
- Sequence:
- MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Isoform 1: Cell membrane
Function
- Function:
- Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-1 can modulate multiple alpha subunit isoforms from brain, skeletal muscle, and heart. Its association with neurofascin may target the sodium channels to the nodes of Ranvier of developing axons and retain these channels at the nodes in mature myelinated axons.
- Cross Reference Drug Bank:
- DB00313 DB00909
- Gene Ontology Go:
- extracellular region
intercalated disc
node of Ranvier
plasma membrane
T-tubule
voltage-gated sodium channel complex
sodium channel inhibitor activity
sodium channel regulator activity
voltage-gated sodium channel activity
voltage-gated sodium channel activity involved in cardiac muscle cell action potential
voltage-gated sodium channel activity involved in Purkinje myocyte action potential
axon guidance
cardiac conduction
cardiac muscle cell action potential involved in contraction
cardiac muscle contraction
cell adhesion
corticospinal neuron axon guidance
locomotion
membrane depolarization
membrane depolarization during cardiac muscle cell action potential
membrane depolarization during Purkinje myocyte cell action potential
neuronal action potential propagation
positive regulation of neuron projection development
positive regulation of sodium ion transport
regulation of atrial cardiac muscle cell membrane depolarization
regulation of heart rate by cardiac conduction
regulation of sodium ion transmembrane transporter activity
regulation of ventricular cardiac muscle cell membrane repolarization
response to pyrethroid
sodium ion transmembrane transport
synaptic transmission - Gene Ontology Biological Process:
- axon guidance
cardiac conduction
cardiac muscle cell action potential involved in contraction
cardiac muscle contraction
cell adhesion
corticospinal neuron axon guidance
locomotion
membrane depolarization
membrane depolarization during cardiac muscle cell action potential
membrane depolarization during Purkinje myocyte cell action potential
neuronal action potential propagation
positive regulation of neuron projection development
positive regulation of sodium ion transport
regulation of atrial cardiac muscle cell membrane depolarization
regulation of heart rate by cardiac conduction
regulation of sodium ion transmembrane transporter activity
regulation of ventricular cardiac muscle cell membrane repolarization
response to pyrethroid
sodium ion transmembrane transport
synaptic transmission - Gene Ontology Molecular Function:
- sodium channel inhibitor activity
sodium channel regulator activity
voltage-gated sodium channel activity
voltage-gated sodium channel activity involved in cardiac muscle cell action potential
voltage-gated sodium channel activity involved in Purkinje myocyte action potential - Gene Ontology Cellular Component:
- extracellular region
intercalated disc
node of Ranvier
plasma membrane
T-tubule
voltage-gated sodium channel complex - Keywords:
- Alternative splicing
Atrial fibrillation
Brugada syndrome
Cell adhesion
Cell membrane
Complete proteome
Disease mutation
Disulfide bond
Epilepsy
Glycoprotein
Immunoglobulin domain
Ion channel
Ion transport
Membrane
Polymorphism
Reference proteome
Secreted
Signal
Sodium
Sodium channel
Sodium transport
Transmembrane
Transmembrane helix
Transport
Voltage-gated channel