Names & Taxonomy
- Uniprot ID:
- Q04771
- Entry Name:
- ACVR1_HUMAN
- Status:
- reviewed
- Protein Names:
- Activin receptor type-1 (EC 2.7.11.30) (Activin receptor type I) (ACTR-I) (Activin receptor-like kinase 2) (ALK-2) (Serine/threonine-protein kinase receptor R1) (SKR1) (TGF-B superfamily receptor type I) (TSR-I)
- Gene Names:
- ACVR1 ACVRLK2
- Gene Names Primary:
- ACVR1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 509
- Sequence:
- MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Single-pass type I membrane protein.
Function
- Function:
- On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis (By similarity).
- Catalytic Activity:
- ATP + = ADP + phosphate.
- Cofactor:
- COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Active Site:
- ACT_SITE 336 336 Proton acceptor.
- Cross Reference Drug Bank:
- DB00171
- Gene Ontology Go:
- activin receptor complex
apical part of cell
integral component of plasma membrane
activin binding
activin receptor activity, type I
ATP binding
metal ion binding
peptide hormone binding
protein homodimerization activity
protein kinase activity
protein serine/threonine kinase activity
receptor signaling protein serine/threonine kinase activity
SMAD binding
transforming growth factor beta binding
transforming growth factor beta receptor activity, type I
transmembrane receptor protein serine/threonine kinase activity
activin receptor signaling pathway
acute inflammatory response
atrial septum primum morphogenesis
BMP signaling pathway
cardiac muscle cell fate commitment
cellular response to BMP stimulus
cellular response to glucocorticoid stimulus
determination of left/right symmetry
embryonic heart tube morphogenesis
endocardial cushion cell fate commitment
G1/S transition of mitotic cell cycle
gastrulation with mouth forming second
germ cell development
in utero embryonic development
mesoderm formation
mitral valve morphogenesis
negative regulation of activin receptor signaling pathway
negative regulation of extrinsic apoptotic signaling pathway
negative regulation of signal transduction
neural crest cell migration
pathway-restricted SMAD protein phosphorylation
patterning of blood vessels
peptidyl-threonine phosphorylation
pharyngeal system development
positive regulation of bone mineralization
positive regulation of cell migration
positive regulation of determination of dorsal identity
positive regulation of osteoblast differentiation
positive regulation of pathway-restricted SMAD protein phosphorylation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription, DNA-templated
protein phosphorylation
regulation of ossification
smooth muscle cell differentiation
transforming growth factor beta receptor signaling pathway - Gene Ontology Biological Process:
- activin receptor signaling pathway
acute inflammatory response
atrial septum primum morphogenesis
BMP signaling pathway
cardiac muscle cell fate commitment
cellular response to BMP stimulus
cellular response to glucocorticoid stimulus
determination of left/right symmetry
embryonic heart tube morphogenesis
endocardial cushion cell fate commitment
G1/S transition of mitotic cell cycle
gastrulation with mouth forming second
germ cell development
in utero embryonic development
mesoderm formation
mitral valve morphogenesis
negative regulation of activin receptor signaling pathway
negative regulation of extrinsic apoptotic signaling pathway
negative regulation of signal transduction
neural crest cell migration
pathway-restricted SMAD protein phosphorylation
patterning of blood vessels
peptidyl-threonine phosphorylation
pharyngeal system development
positive regulation of bone mineralization
positive regulation of cell migration
positive regulation of determination of dorsal identity
positive regulation of osteoblast differentiation
positive regulation of pathway-restricted SMAD protein phosphorylation
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
protein phosphorylation
regulation of ossification
smooth muscle cell differentiation
transforming growth factor beta receptor signaling pathway - Gene Ontology Molecular Function:
- activin binding
activin receptor activity, type I
ATP binding
metal ion binding
peptide hormone binding
protein homodimerization activity
protein kinase activity
protein serine/threonine kinase activity
receptor signaling protein serine/threonine kinase activity
SMAD binding
transforming growth factor beta binding
transforming growth factor beta receptor activity, type I
transmembrane receptor protein serine/threonine kinase activity - Gene Ontology Cellular Component:
- activin receptor complex
apical part of cell
integral component of plasma membrane - Keywords:
- 3D-structure
ATP-binding
Complete proteome
Disease mutation
Glycoprotein
Kinase
Magnesium
Manganese
Membrane
Metal-binding
Nucleotide-binding
Phosphoprotein
Polymorphism
Receptor
Reference proteome
Serine/threonine-protein kinase
Signal
Transferase
Transmembrane
Transmembrane helix