Drug Miner Browse

Uniprot ID:: Q01362
Entry Name:: FCERB_HUMAN
Status:: reviewed
Protein Names:: High affinity immunoglobulin epsilon receptor subunit beta (FcERI) (Fc epsilon receptor I beta-chain) (IgE Fc receptor subunit beta) (Membrane-spanning 4-domains subfamily A member 2)
Gene Names:: MS4A2 APY FCER1B IGER
Gene Names Primary:: MS4A2
Organism:: Homo sapiens (Human)

Length:: 244
Sequence:: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
Proteomes:: UP000005640

Function:: High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy.
Cross Reference Drug Bank:: DB00043
Gene Ontology Go:: external side of plasma membrane
Fc-epsilon receptor I complex
integral component of plasma membrane
plasma membrane
Fc-epsilon receptor signaling pathway
immune response
inflammatory response
innate immune response
Gene Ontology Biological Process:: Fc-epsilon receptor signaling pathway
immune response
inflammatory response
innate immune response
Gene Ontology Cellular Component:: external side of plasma membrane
Fc-epsilon receptor I complex
integral component of plasma membrane
plasma membrane
Keywords:: Complete proteome
Disulfide bond
IgE-binding protein
Membrane
Phosphoprotein
Polymorphism
Receptor
Reference proteome
Transmembrane
Transmembrane helix