Names & Taxonomy
- Uniprot ID:
- P78508
- Entry Name:
- KCJ10_HUMAN
- Status:
- reviewed
- Protein Names:
- ATP-sensitive inward rectifier potassium channel 10 (ATP-dependent inwardly rectifying potassium channel Kir4.1) (Inward rectifier K(+) channel Kir1.2) (Potassium channel, inwardly rectifying subfamily J member 10)
- Gene Names:
- KCNJ10
- Gene Names Primary:
- KCNJ10
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 379
- Sequence:
- MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane
- Intramembrane:
- INTRAMEM 115 126 Helical; Pore-forming; Name=H5.
Function
- Function:
- May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules.
- Cross Reference Drug Bank:
- DB01392
- Gene Ontology Go:
- basolateral plasma membrane
integral component of plasma membrane
plasma membrane
presynapse
ATP binding
ATP-activated inward rectifier potassium channel activity
adult walking behavior
central nervous system myelination
glutamate reuptake
potassium ion homeostasis
potassium ion import
potassium ion transport
regulation of long-term neuronal synaptic plasticity
regulation of resting membrane potential
synaptic transmission
visual perception - Gene Ontology Biological Process:
- adult walking behavior
central nervous system myelination
glutamate reuptake
potassium ion homeostasis
potassium ion import
potassium ion transport
regulation of long-term neuronal synaptic plasticity
regulation of resting membrane potential
synaptic transmission
visual perception - Gene Ontology Molecular Function:
- ATP-activated inward rectifier potassium channel activity
ATP binding - Gene Ontology Cellular Component:
- basolateral plasma membrane
integral component of plasma membrane
plasma membrane
presynapse - Keywords:
- ATP-binding
Cell membrane
Complete proteome
Deafness
Disease mutation
Epilepsy
Ion channel
Ion transport
Membrane
Mental retardation
Nucleotide-binding
Phosphoprotein
Polymorphism
Potassium
Potassium transport
Reference proteome
Transmembrane
Transmembrane helix
Transport
Voltage-gated channel - Interacts With:
- F1PK57; Q8IUQ4