Names & Taxonomy
- Uniprot ID:
- P62330
- Entry Name:
- ARF6_HUMAN
- Status:
- reviewed
- Protein Names:
- ADP-ribosylation factor 6
- Gene Names:
- ARF6
- Gene Names Primary:
- ARF6
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 175
- Sequence:
- MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Golgi apparatus. Cell membrane; Lipid-anchor. Endosome membrane; Lipid-anchor. Recycling endosome membrane
Function
- Function:
- GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
- Enzyme Regulation:
- ENZYME REGULATION: Activation is generally mediated by a guanine exchange factor (GEF), while inactivation through hydrolysis of bound GTP is catalyzed by a GTPase activating protein (GAP). Activated by ASAP3. Inactivated by ACAP1 and ACAP2.
- Gene Ontology Go:
- cell cortex
cleavage furrow
early endosome
endocytic vesicle
endosome
extracellular exosome
filopodium membrane
focal adhesion
Golgi apparatus
membrane
midbody
myelin sheath
plasma membrane
recycling endosome membrane
ruffle
GTP binding
GTPase activity
thioesterase binding
cell adhesion
cell cycle
cell division
cortical actin cytoskeleton organization
establishment of epithelial cell polarity
hepatocyte apoptotic process
liver development
movement of cell or subcellular component
myeloid cell apoptotic process
negative regulation of dendrite development
negative regulation of receptor-mediated endocytosis
positive regulation of actin filament polymerization
positive regulation of establishment of protein localization to plasma membrane
protein localization to cell surface
protein localization to endosome
protein transport
regulation of dendritic spine development
regulation of filopodium assembly
regulation of Rac protein signal transduction
ruffle organization
small GTPase mediated signal transduction
vesicle-mediated transport - Gene Ontology Biological Process:
- cell adhesion
cell cycle
cell division
cortical actin cytoskeleton organization
establishment of epithelial cell polarity
hepatocyte apoptotic process
liver development
movement of cell or subcellular component
myeloid cell apoptotic process
negative regulation of dendrite development
negative regulation of receptor-mediated endocytosis
positive regulation of actin filament polymerization
positive regulation of establishment of protein localization to plasma membrane
protein localization to cell surface
protein localization to endosome
protein transport
regulation of dendritic spine development
regulation of filopodium assembly
regulation of Rac protein signal transduction
ruffle organization
small GTPase mediated signal transduction
vesicle-mediated transport - Gene Ontology Molecular Function:
- GTPase activity
GTP binding
thioesterase binding - Gene Ontology Cellular Component:
- cell cortex
cleavage furrow
early endosome
endocytic vesicle
endosome
extracellular exosome
filopodium membrane
focal adhesion
Golgi apparatus
membrane
midbody
myelin sheath
plasma membrane
recycling endosome membrane
ruffle - Keywords:
- 3D-structure
Cell cycle
Cell division
Cell membrane
Cell projection
Complete proteome
Cytoplasm
Differentiation
ER-Golgi transport
Endosome
GTP-binding
Golgi apparatus
Lipoprotein
Membrane
Myristate
Neurogenesis
Nucleotide-binding
Protein transport
Reference proteome
Transport - Interacts With:
- P53365; P21283; Q02241; O60271
Publication
- PubMed ID:
- 1993656 14659046 9653160 14702039 15489334 7589240 11062263 12847086 15509780 14978216 16148947 15642342 15793564 16737952 17030804 17398095 17628206 17555535 18400762 20727515 19948740 20682791 21269460 21951725 24275569 25255805 25944712 10881192 11266366 16099990 16839550 19644450 20510928 21170023 22939626 23940353