Names & Taxonomy
- Uniprot ID:
- P62258
- Entry Name:
- 1433E_HUMAN
- Status:
- reviewed
- Protein Names:
- 14-3-3 protein epsilon (14-3-3E)
- Gene Names:
- YWHAE
- Gene Names Primary:
- YWHAE
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 255
- Sequence:
- MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm
Function
- Function:
- Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
- Gene Ontology Go:
- axon
cytoplasmic vesicle membrane
cytosol
extracellular exosome
focal adhesion
kinesin complex
melanosome
membrane
mitochondrion
enzyme binding
histone deacetylase binding
ion channel binding
MHC class II protein complex binding
phosphoprotein binding
phosphoserine binding
poly(A) RNA binding
potassium channel regulator activity
protein heterodimerization activity
ubiquitin protein ligase binding
apoptotic process
apoptotic signaling pathway
cellular response to heat
cerebral cortex development
G2/M transition of mitotic cell cycle
gene expression
hippo signaling
hippocampus development
intracellular signal transduction
intrinsic apoptotic signaling pathway
membrane organization
membrane repolarization during cardiac muscle cell action potential
mitotic cell cycle
negative regulation of peptidyl-serine dephosphorylation
neuron migration
neurotrophin TRK receptor signaling pathway
organelle organization
positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
programmed cell death
protein targeting
regulation of cellular response to heat
regulation of cysteine-type endopeptidase activity involved in apoptotic process
regulation of heart rate by cardiac conduction
regulation of heart rate by hormone
regulation of membrane repolarization
regulation of potassium ion transmembrane transporter activity
small GTPase mediated signal transduction
substantia nigra development
transcription initiation from RNA polymerase II promoter
viral process - Gene Ontology Biological Process:
- apoptotic process
apoptotic signaling pathway
cellular response to heat
cerebral cortex development
G2/M transition of mitotic cell cycle
gene expression
hippocampus development
hippo signaling
intracellular signal transduction
intrinsic apoptotic signaling pathway
membrane organization
membrane repolarization during cardiac muscle cell action potential
mitotic cell cycle
negative regulation of peptidyl-serine dephosphorylation
neuron migration
neurotrophin TRK receptor signaling pathway
organelle organization
positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
programmed cell death
protein targeting
regulation of cellular response to heat
regulation of cysteine-type endopeptidase activity involved in apoptotic process
regulation of heart rate by cardiac conduction
regulation of heart rate by hormone
regulation of membrane repolarization
regulation of potassium ion transmembrane transporter activity
small GTPase mediated signal transduction
substantia nigra development
transcription initiation from RNA polymerase II promoter
viral process - Gene Ontology Molecular Function:
- enzyme binding
histone deacetylase binding
ion channel binding
MHC class II protein complex binding
phosphoprotein binding
phosphoserine binding
poly(A) RNA binding
potassium channel regulator activity
protein heterodimerization activity
ubiquitin protein ligase binding - Gene Ontology Cellular Component:
- axon
cytoplasmic vesicle membrane
cytosol
extracellular exosome
focal adhesion
kinesin complex
melanosome
membrane
mitochondrion - Keywords:
- 3D-structure
Acetylation
Alternative splicing
Complete proteome
Cytoplasm
Direct protein sequencing
Host-virus interaction
Phosphoprotein
Reference proteome - Interacts With:
- O92972; Q96AP0; O14727; P10398; O00257-3; O94921; Q9UKT5; P56524; Q14678-2; Q5S007; Q99759; O15151; P58340; O35244; P04049; P61588; Q99469; Q9GZV5; P31946; P61981; P63104