Names & Taxonomy
- Uniprot ID:
- P61769
- Entry Name:
- B2MG_HUMAN
- Status:
- reviewed
- Protein Names:
- Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]
- Gene Names:
- B2M CDABP0092 HDCMA22P
- Gene Names Orf:
- CDABP0092 HDCMA22P
- Gene Names Primary:
- B2M
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 119
- Sequence:
- MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted
Function
- Function:
- Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.
- Cross Reference Drug Bank:
- DB00254
- Gene Ontology Go:
- cytoplasm
early endosome lumen
early endosome membrane
endoplasmic reticulum lumen
ER to Golgi transport vesicle membrane
external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
focal adhesion
Golgi apparatus
Golgi membrane
HFE-transferrin receptor complex
membrane
MHC class I protein complex
phagocytic vesicle membrane
plasma membrane
glycoprotein binding
identical protein binding
antibacterial humoral response
antigen processing and presentation of endogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent
antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
cellular protein metabolic process
cellular response to iron ion
cellular response to lipopolysaccharide
cytokine-mediated signaling pathway
defense response to Gram-negative bacterium
defense response to Gram-positive bacterium
innate immune response
interferon-gamma-mediated signaling pathway
iron ion homeostasis
negative regulation of neuron projection development
negative regulation of receptor binding
positive regulation of ferrous iron binding
positive regulation of ferrous iron import into cell
positive regulation of protein binding
positive regulation of receptor binding
positive regulation of receptor-mediated endocytosis
positive regulation of T cell cytokine production
positive regulation of T cell mediated cytotoxicity
positive regulation of transferrin receptor binding
protein refolding
regulation of defense response to virus by virus
regulation of immune response
regulation of membrane depolarization
response to cadmium ion
response to drug
retina homeostasis
T cell differentiation in thymus
viral process - Gene Ontology Biological Process:
- antibacterial humoral response
antigen processing and presentation of endogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent
antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
cellular protein metabolic process
cellular response to iron ion
cellular response to lipopolysaccharide
cytokine-mediated signaling pathway
defense response to Gram-negative bacterium
defense response to Gram-positive bacterium
innate immune response
interferon-gamma-mediated signaling pathway
iron ion homeostasis
negative regulation of neuron projection development
negative regulation of receptor binding
positive regulation of ferrous iron binding
positive regulation of ferrous iron import into cell
positive regulation of protein binding
positive regulation of receptor binding
positive regulation of receptor-mediated endocytosis
positive regulation of T cell cytokine production
positive regulation of T cell mediated cytotoxicity
positive regulation of transferrin receptor binding
protein refolding
regulation of defense response to virus by virus
regulation of immune response
regulation of membrane depolarization
response to cadmium ion
response to drug
retina homeostasis
T cell differentiation in thymus
viral process - Gene Ontology Molecular Function:
- glycoprotein binding
identical protein binding - Gene Ontology Cellular Component:
- cytoplasm
early endosome lumen
early endosome membrane
endoplasmic reticulum lumen
ER to Golgi transport vesicle membrane
external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
focal adhesion
Golgi apparatus
Golgi membrane
HFE-transferrin receptor complex
membrane
MHC class I protein complex
phagocytic vesicle membrane
plasma membrane - Keywords:
- 3D-structure
Amyloid
Amyloidosis
Complete proteome
Direct protein sequencing
Disease mutation
Disulfide bond
Glycation
Glycoprotein
Immunity
Immunoglobulin domain
MHC I
Pyrrolidone carboxylic acid
Reference proteome
Secreted
Signal - Interacts With:
- Itself; P06126; P29016; Q30201