Names & Taxonomy
- Uniprot ID:
- P54619
- Entry Name:
- AAKG1_HUMAN
- Status:
- reviewed
- Protein Names:
- 5'-AMP-activated protein kinase subunit gamma-1 (AMPK gamma1) (AMPK subunit gamma-1) (AMPKg)
- Gene Names:
- PRKAG1
- Gene Names Primary:
- PRKAG1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 331
- Sequence:
- METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
- Proteomes:
- UP000005640
Function
- Function:
- AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.
- Cross Reference Drug Bank:
- DB00945
- Gene Ontology Go:
- cytosol
extracellular exosome
membrane
nucleotide-activated protein kinase complex
nucleus
ADP binding
AMP binding
ATP binding
cAMP-dependent protein kinase activity
cAMP-dependent protein kinase regulator activity
protein kinase activity
protein kinase binding
cell cycle arrest
fatty acid biosynthetic process
gene expression
insulin receptor signaling pathway
macroautophagy
membrane organization
mitochondrion organization
organelle organization
positive regulation of gene expression
positive regulation of protein kinase activity
protein phosphorylation
regulation of glycolytic process
signal transduction
spermatogenesis
transcription initiation from RNA polymerase II promoter - Gene Ontology Biological Process:
- cell cycle arrest
fatty acid biosynthetic process
gene expression
insulin receptor signaling pathway
macroautophagy
membrane organization
mitochondrion organization
organelle organization
positive regulation of gene expression
positive regulation of protein kinase activity
protein phosphorylation
regulation of glycolytic process
signal transduction
spermatogenesis
transcription initiation from RNA polymerase II promoter - Gene Ontology Molecular Function:
- ADP binding
AMP binding
ATP binding
cAMP-dependent protein kinase activity
cAMP-dependent protein kinase regulator activity
protein kinase activity
protein kinase binding - Gene Ontology Cellular Component:
- cytosol
extracellular exosome
membrane
nucleotide-activated protein kinase complex
nucleus - Keywords:
- 3D-structure
ATP-binding
Alternative splicing
CBS domain
Complete proteome
Direct protein sequencing
Fatty acid biosynthesis
Fatty acid metabolism
Lipid biosynthesis
Lipid metabolism
Nucleotide-binding
Phosphoprotein
Polymorphism
Reference proteome
Repeat - Interacts With:
- Q6P1W5; P35520; Q14145; Q9BYR5; Q13131; P54646; Q9Y478; O43741; Q969V4