Names & Taxonomy
- Uniprot ID:
- P49720
- Entry Name:
- PSB3_HUMAN
- Status:
- reviewed
- Protein Names:
- Proteasome subunit beta type-3 (EC 3.4.25.1) (Proteasome chain 13) (Proteasome component C10-II) (Proteasome theta chain)
- Gene Names:
- PSMB3
- Gene Names Primary:
- PSMB3
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 205
- Sequence:
- MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm. Nucleus.
Function
- Function:
- The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
- Catalytic Activity:
- Cleavage of peptide bonds with very broad specificity.
- Cross Reference Drug Bank:
- DB00188
- Gene Ontology Go:
- actin cytoskeleton
cytoplasm
cytosol
extracellular exosome
Golgi apparatus
mitochondrion
nucleoplasm
nucleus
proteasome complex
proteasome core complex
threonine-type endopeptidase activity
activation of MAPKK activity
anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
apoptotic process
axon guidance
cellular nitrogen compound metabolic process
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
G1/S transition of mitotic cell cycle
gene expression
innate immune response
insulin receptor signaling pathway
MAPK cascade
mitotic cell cycle
negative regulation of apoptotic process
negative regulation of canonical Wnt signaling pathway
negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
neurotrophin TRK receptor signaling pathway
NIK/NF-kappaB signaling
polyamine metabolic process
positive regulation of canonical Wnt signaling pathway
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
programmed cell death
protein polyubiquitination
Ras protein signal transduction
regulation of apoptotic process
regulation of cellular amino acid metabolic process
regulation of mRNA stability
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
small GTPase mediated signal transduction
small molecule metabolic process
stimulatory C-type lectin receptor signaling pathway
T cell receptor signaling pathway
tumor necrosis factor-mediated signaling pathway
vascular endothelial growth factor receptor signaling pathway
viral process - Gene Ontology Biological Process:
- activation of MAPKK activity
anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
apoptotic process
axon guidance
cellular nitrogen compound metabolic process
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
G1/S transition of mitotic cell cycle
gene expression
innate immune response
insulin receptor signaling pathway
MAPK cascade
mitotic cell cycle
negative regulation of apoptotic process
negative regulation of canonical Wnt signaling pathway
negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
neurotrophin TRK receptor signaling pathway
NIK/NF-kappaB signaling
polyamine metabolic process
positive regulation of canonical Wnt signaling pathway
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
programmed cell death
protein polyubiquitination
Ras protein signal transduction
regulation of apoptotic process
regulation of cellular amino acid metabolic process
regulation of mRNA stability
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
small GTPase mediated signal transduction
small molecule metabolic process
stimulatory C-type lectin receptor signaling pathway
T cell receptor signaling pathway
tumor necrosis factor-mediated signaling pathway
vascular endothelial growth factor receptor signaling pathway
viral process - Gene Ontology Molecular Function:
- threonine-type endopeptidase activity
- Gene Ontology Cellular Component:
- actin cytoskeleton
cytoplasm
cytosol
extracellular exosome
Golgi apparatus
mitochondrion
nucleoplasm
nucleus
proteasome complex
proteasome core complex - Keywords:
- 3D-structure
Acetylation
Complete proteome
Cytoplasm
Direct protein sequencing
Host-virus interaction
Hydrolase
Nucleus
Polymorphism
Protease
Proteasome
Reference proteome
Threonine protease - Interacts With:
- P49721; P14373