Names & Taxonomy
- Uniprot ID:
- P48065
- Entry Name:
- S6A12_HUMAN
- Status:
- reviewed
- Protein Names:
- Sodium- and chloride-dependent betaine transporter (BGT-1) (Na(+)/Cl(-) betaine/GABA transporter) (Solute carrier family 6 member 12)
- Gene Names:
- SLC6A12
- Gene Names Primary:
- SLC6A12
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 614
- Sequence:
- MDGKVAVQECGPPAVSWVPEEGEKLDQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHCTDFLNHSGAGTVTPFENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGRRELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADRFYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Multi-pass membrane protein.
Function
- Function:
- Transports betaine and GABA. May have a role in regulation of GABAergic transmission in the brain through the reuptake of GABA into presynaptic terminals, as well as in osmotic regulation.
- Gene Ontology Go:
- integral component of membrane
integral component of plasma membrane
neuron projection
plasma membrane
presynapse
gamma-aminobutyric acid:sodium symporter activity
neurotransmitter:sodium symporter activity
amino acid transport
cellular hyperosmotic response
cellular water homeostasis
gamma-aminobutyric acid transport
ion transport
neurotransmitter secretion
neurotransmitter transport
response to organic substance
synaptic transmission
transmembrane transport
transport - Gene Ontology Biological Process:
- amino acid transport
cellular hyperosmotic response
cellular water homeostasis
gamma-aminobutyric acid transport
ion transport
neurotransmitter secretion
neurotransmitter transport
response to organic substance
synaptic transmission
transmembrane transport
transport - Gene Ontology Molecular Function:
- gamma-aminobutyric acid:sodium symporter activity
neurotransmitter:sodium symporter activity - Gene Ontology Cellular Component:
- integral component of membrane
integral component of plasma membrane
neuron projection
plasma membrane
presynapse - Keywords:
- Complete proteome
Disulfide bond
Glycoprotein
Membrane
Neurotransmitter transport
Polymorphism
Reference proteome
Symport
Transmembrane
Transmembrane helix
Transport - Interacts With:
- Q04864