Names & Taxonomy
- Uniprot ID:
- P48061
- Entry Name:
- SDF1_HUMAN
- Status:
- reviewed
- Protein Names:
- Stromal cell-derived factor 1 (SDF-1) (hSDF-1) (C-X-C motif chemokine 12) (Intercrine reduced in hepatomas) (IRH) (hIRH) (Pre-B cell growth-stimulating factor) (PBSF) [Cleaved into: SDF-1-beta(3-72); SDF-1-alpha(3-67)]
- Gene Names:
- CXCL12 SDF1 SDF1A SDF1B
- Gene Names Primary:
- CXCL12
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 93
- Sequence:
- MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.
- Cross Reference Drug Bank:
- DB06822
- Gene Ontology Go:
- external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
chemoattractant activity
chemokine activity
chemokine receptor binding
CXCR chemokine receptor binding
receptor binding
adult locomotory behavior
axon guidance
blood circulation
cell adhesion
cell chemotaxis
cellular calcium ion homeostasis
chemokine-mediated signaling pathway
chemotaxis
G-protein coupled receptor signaling pathway
immune response
induction of positive chemotaxis
negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
negative regulation of leukocyte apoptotic process
negative regulation of leukocyte tethering or rolling
neuron migration
organ regeneration
positive chemotaxis
positive regulation of axon extension involved in axon guidance
positive regulation of calcium ion import
positive regulation of cell adhesion
positive regulation of dopamine secretion
positive regulation of endothelial cell proliferation
positive regulation of monocyte chemotaxis
positive regulation of T cell migration
regulation of actin polymerization or depolymerization
response to heat
response to hypoxia
response to mechanical stimulus
response to peptide hormone
response to radiation
response to virus
signal transduction
telencephalon cell migration - Gene Ontology Biological Process:
- adult locomotory behavior
axon guidance
blood circulation
cell adhesion
cell chemotaxis
cellular calcium ion homeostasis
chemokine-mediated signaling pathway
chemotaxis
G-protein coupled receptor signaling pathway
immune response
induction of positive chemotaxis
negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
negative regulation of leukocyte apoptotic process
negative regulation of leukocyte tethering or rolling
neuron migration
organ regeneration
positive chemotaxis
positive regulation of axon extension involved in axon guidance
positive regulation of calcium ion import
positive regulation of cell adhesion
positive regulation of dopamine secretion
positive regulation of endothelial cell proliferation
positive regulation of monocyte chemotaxis
positive regulation of T cell migration
regulation of actin polymerization or depolymerization
response to heat
response to hypoxia
response to mechanical stimulus
response to peptide hormone
response to radiation
response to virus
signal transduction
telencephalon cell migration - Gene Ontology Molecular Function:
- chemoattractant activity
chemokine activity
chemokine receptor binding
CXCR chemokine receptor binding
receptor binding - Gene Ontology Cellular Component:
- external side of plasma membrane
extracellular exosome
extracellular region
extracellular space - Keywords:
- 3D-structure
Alternative splicing
Chemotaxis
Complete proteome
Cytokine
Disulfide bond
Growth factor
Reference proteome
Secreted
Signal