Names & Taxonomy
- Uniprot ID:
- P41091
- Entry Name:
- IF2G_HUMAN
- Status:
- reviewed
- Protein Names:
- Eukaryotic translation initiation factor 2 subunit 3 (Eukaryotic translation initiation factor 2 subunit gamma X) (eIF-2-gamma X) (eIF-2gX)
- Gene Names:
- EIF2S3 EIF2G
- Gene Names Primary:
- EIF2S3
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 472
- Sequence:
- MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
- Proteomes:
- UP000005640
Function
- Function:
- As a subunit of eukaryotic initiation factor 2 (eIF2), involved in the early steps of protein synthesis. In the presence of GTP, eIF2 forms a ternary complex with initiator tRNA Met-tRNAi and then recruits the 40S ribosomal complex, a step that determines the rate of protein translation. This step is followed by mRNA binding to form the 43S pre-initiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF2 and release of an eIF2-GDP binary complex. In order for eIF2 to recycle and catalyze another round of initiation, the GDP bound to eIF2 must exchange with GTP by way of a reaction catalyzed by eIF2B (By similarity). Along with its paralog on chromosome Y, may contribute to spermatogenesis up to the round spermatid stage (By similarity).
- Gene Ontology Go:
- cytoplasm
cytosol
extracellular exosome
GTP binding
GTPase activity
translation factor activity, RNA binding
translation initiation factor activity
cellular protein metabolic process
formation of translation preinitiation complex
gene expression
translation
translational initiation
transmembrane transport - Gene Ontology Biological Process:
- cellular protein metabolic process
formation of translation preinitiation complex
gene expression
translation
translational initiation
transmembrane transport - Gene Ontology Molecular Function:
- GTPase activity
GTP binding
translation factor activity, RNA binding
translation initiation factor activity - Gene Ontology Cellular Component:
- cytoplasm
cytosol
extracellular exosome - Keywords:
- Acetylation
Complete proteome
Direct protein sequencing
GTP-binding
Initiation factor
Nucleotide-binding
Phosphoprotein
Polymorphism
Protein biosynthesis
Reference proteome - Interacts With:
- P05198; P20042