Names & Taxonomy
- Uniprot ID:
- P35080
- Entry Name:
- PROF2_HUMAN
- Status:
- reviewed
- Protein Names:
- Profilin-2 (Profilin II)
- Gene Names:
- PFN2
- Gene Names Primary:
- PFN2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 140
- Sequence:
- MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm, cytoskeleton.
Function
- Function:
- Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
- Gene Ontology Go:
- cytoplasm
cytoskeleton
extracellular exosome
terminal bouton
actin monomer binding
adenyl-nucleotide exchange factor activity
phosphatidylinositol-4,5-bisphosphate binding
actin cytoskeleton organization
negative regulation of actin filament polymerization
negative regulation of epithelial cell migration
negative regulation of ruffle assembly
positive regulation of actin filament bundle assembly
positive regulation of actin filament polymerization
positive regulation of ATPase activity
positive regulation of peptidyl-serine phosphorylation
positive regulation of stress fiber assembly
protein stabilization
regulation of synaptic vesicle exocytosis - Gene Ontology Biological Process:
- actin cytoskeleton organization
negative regulation of actin filament polymerization
negative regulation of epithelial cell migration
negative regulation of ruffle assembly
positive regulation of actin filament bundle assembly
positive regulation of actin filament polymerization
positive regulation of ATPase activity
positive regulation of peptidyl-serine phosphorylation
positive regulation of stress fiber assembly
protein stabilization
regulation of synaptic vesicle exocytosis - Gene Ontology Molecular Function:
- actin monomer binding
adenyl-nucleotide exchange factor activity
phosphatidylinositol-4,5-bisphosphate binding - Gene Ontology Cellular Component:
- cytoplasm
cytoskeleton
extracellular exosome
terminal bouton - Keywords:
- 3D-structure
Acetylation
Actin-binding
Alternative splicing
Complete proteome
Cytoplasm
Cytoskeleton
Direct protein sequencing
Reference proteome - Interacts With:
- Q14789; P42858; O08816