Names & Taxonomy
- Uniprot ID:
- P31645
- Entry Name:
- SC6A4_HUMAN
- Status:
- reviewed
- Protein Names:
- Sodium-dependent serotonin transporter (SERT) (5HT transporter) (5HTT) (Solute carrier family 6 member 4)
- Gene Names:
- SLC6A4 HTT SERT
- Gene Names Primary:
- SLC6A4
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 630
- Sequence:
- METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
- Cross Reference Drug Bank:
- DB00321 DB00543 DB00182 DB00289 DB09016 DB01114 DB00215 DB01242 DB00907 DB01151 DB06700 DB01191 DB06701 DB00514 DB00988 DB01142 DB00476 DB01363 DB01175 DB00472 DB00176 DB00458 DB08918 DB00408 DB00579 DB01577 DB00422 DB06148 DB04896 DB00805 DB00370 DB01149 DB00540 DB00715 DB00454 DB00191 DB00344 DB00852 DB01104 DB01105 DB06204 DB00193 DB00656 DB00726 DB00285 DB00661 DB06684 DB09068
- Gene Ontology Go:
- cytosol
endomembrane system
endosome membrane
integral component of plasma membrane
membrane raft
neuron projection
plasma membrane
presynapse
actin filament binding
cocaine binding
metal ion binding
monoamine transmembrane transporter activity
Rab GTPase binding
serotonin transmembrane transporter activity
serotonin:sodium symporter activity
brain morphogenesis
cellular response to cGMP
cellular response to retinoic acid
circadian rhythm
memory
monoamine transport
negative regulation of cerebellar granule cell precursor proliferation
negative regulation of neuron differentiation
negative regulation of organ growth
negative regulation of synaptic transmission, dopaminergic
positive regulation of cell cycle
positive regulation of gene expression
protein homooligomerization
protein oligomerization
response to drug
response to estradiol
response to hypoxia
response to nutrient
response to toxic substance
serotonin transport
serotonin uptake
social behavior
sperm ejaculation
synaptic transmission
thalamus development
vasoconstriction - Gene Ontology Biological Process:
- brain morphogenesis
cellular response to cGMP
cellular response to retinoic acid
circadian rhythm
memory
monoamine transport
negative regulation of cerebellar granule cell precursor proliferation
negative regulation of neuron differentiation
negative regulation of organ growth
negative regulation of synaptic transmission, dopaminergic
positive regulation of cell cycle
positive regulation of gene expression
protein homooligomerization
protein oligomerization
response to drug
response to estradiol
response to hypoxia
response to nutrient
response to toxic substance
serotonin transport
serotonin uptake
social behavior
sperm ejaculation
synaptic transmission
thalamus development
vasoconstriction - Gene Ontology Molecular Function:
- actin filament binding
cocaine binding
metal ion binding
monoamine transmembrane transporter activity
Rab GTPase binding
serotonin:sodium symporter activity
serotonin transmembrane transporter activity - Gene Ontology Cellular Component:
- cytosol
endomembrane system
endosome membrane
integral component of plasma membrane
membrane raft
neuron projection
plasma membrane
presynapse - Keywords:
- Alternative splicing
Cell membrane
Complete proteome
Disulfide bond
Endosome
Glycoprotein
Membrane
Metal-binding
Neurotransmitter transport
Phosphoprotein
Polymorphism
Reference proteome
Sodium
Symport
Transmembrane
Transmembrane helix
Transport