Names & Taxonomy
- Uniprot ID:
- P30536
- Entry Name:
- TSPOA_HUMAN
- Status:
- reviewed
- Protein Names:
- Translocator protein (Mitochondrial benzodiazepine receptor) (PKBS) (Peripheral-type benzodiazepine receptor) (PBR)
- Gene Names:
- TSPO BZRP MBR
- Gene Names Primary:
- TSPO
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 169
- Sequence:
- MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Mitochondrion membrane
Function
- Function:
- Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:24814875), but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides (PubMed:1847678).
- Cross Reference Drug Bank:
- DB01178 DB01068 DB00628 DB00829 DB00402 DB01544 DB01587 DB00186 DB00231 DB00897 DB00962 DB01198
- Gene Ontology Go:
- cytoplasm
extracellular exosome
integral component of membrane
intracellular membrane-bounded organelle
mitochondrial outer membrane
mitochondrion
nuclear membrane
postsynapse
androgen binding
benzodiazepine receptor activity
cholesterol binding
adrenal gland development
aging
anion transport
apoptotic process
behavioral response to pain
cell proliferation
cellular hypotonic response
cellular response to lipopolysaccharide
cellular response to zinc ion
chemical synaptic transmission, postsynaptic
chloride transport
contact inhibition
glial cell migration
heme biosynthetic process
lipid transport
maintenance of protein location in mitochondrion
negative regulation of ATP metabolic process
negative regulation of glial cell proliferation
negative regulation of mitophagy
negative regulation of nitric oxide biosynthetic process
negative regulation of protein ubiquitination
negative regulation of tumor necrosis factor production
peripheral nervous system axon regeneration
positive regulation of apoptotic process
positive regulation of calcium ion transport
positive regulation of glial cell proliferation
positive regulation of mitochondrial depolarization
positive regulation of necrotic cell death
positive regulation of reactive oxygen species metabolic process
protein targeting to mitochondrion
regulation of cholesterol transport
regulation of steroid biosynthetic process
response to drug
response to manganese ion
response to progesterone
response to testosterone
response to vitamin B1
steroid biosynthetic process
steroid metabolic process - Gene Ontology Biological Process:
- adrenal gland development
aging
anion transport
apoptotic process
behavioral response to pain
cell proliferation
cellular hypotonic response
cellular response to lipopolysaccharide
cellular response to zinc ion
chemical synaptic transmission, postsynaptic
chloride transport
contact inhibition
glial cell migration
heme biosynthetic process
lipid transport
maintenance of protein location in mitochondrion
negative regulation of ATP metabolic process
negative regulation of glial cell proliferation
negative regulation of mitophagy
negative regulation of nitric oxide biosynthetic process
negative regulation of protein ubiquitination
negative regulation of tumor necrosis factor production
peripheral nervous system axon regeneration
positive regulation of apoptotic process
positive regulation of calcium ion transport
positive regulation of glial cell proliferation
positive regulation of mitochondrial depolarization
positive regulation of necrotic cell death
positive regulation of reactive oxygen species metabolic process
protein targeting to mitochondrion
regulation of cholesterol transport
regulation of steroid biosynthetic process
response to drug
response to manganese ion
response to progesterone
response to testosterone
response to vitamin B1
steroid biosynthetic process
steroid metabolic process - Gene Ontology Molecular Function:
- androgen binding
benzodiazepine receptor activity
cholesterol binding - Gene Ontology Cellular Component:
- cytoplasm
extracellular exosome
integral component of membrane
intracellular membrane-bounded organelle
mitochondrial outer membrane
mitochondrion
nuclear membrane
postsynapse - Keywords:
- Alternative splicing
Complete proteome
Lipid transport
Membrane
Mitochondrion
Polymorphism
Receptor
Reference proteome
Transmembrane
Transmembrane helix
Transport - Interacts With:
- Q96BA8