Names & Taxonomy
- Uniprot ID:
- P29034
- Entry Name:
- S10A2_HUMAN
- Status:
- reviewed
- Protein Names:
- Protein S100-A2 (CAN19) (Protein S-100L) (S100 calcium-binding protein A2)
- Gene Names:
- S100A2 S100L
- Gene Names Primary:
- S100A2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 98
- Sequence:
- MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
- Proteomes:
- UP000005640
Function
- Function:
- May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play a role in suppressing tumor cell growth.
- Cross Reference Drug Bank:
- DB00768
- Gene Ontology Go:
- calcium ion binding
identical protein binding
endothelial cell migration - Gene Ontology Biological Process:
- endothelial cell migration
- Gene Ontology Molecular Function:
- calcium ion binding
identical protein binding - Keywords:
- 3D-structure
Calcium
Complete proteome
Direct protein sequencing
Metal-binding
Reference proteome
Repeat - Interacts With:
- Itself; Q02790; P52292; P52293; Q00987; P26882; P23297; P04271; P04637