Names & Taxonomy
- Uniprot ID:
- P28070
- Entry Name:
- PSB4_HUMAN
- Status:
- reviewed
- Protein Names:
- Proteasome subunit beta type-4 (EC 3.4.25.1) (26 kDa prosomal protein) (HsBPROS26) (PROS-26) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome beta chain) (Proteasome chain 3) (HsN3)
- Gene Names:
- PSMB4 PROS26
- Gene Names Primary:
- PSMB4
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 264
- Sequence:
- MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm
Function
- Function:
- The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal macrophage proteasome (By similarity). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1.
- Catalytic Activity:
- Cleavage of peptide bonds with very broad specificity.
- Active Site:
- ACT_SITE 46 46 Nucleophile.
- Cross Reference Drug Bank:
- DB00188
- Gene Ontology Go:
- cytosol
extracellular exosome
nucleoplasm
nucleus
proteasome complex
proteasome core complex
lipopolysaccharide binding
threonine-type endopeptidase activity
activation of MAPKK activity
anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
apoptotic process
axon guidance
cellular nitrogen compound metabolic process
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
G1/S transition of mitotic cell cycle
gene expression
innate immune response
insulin receptor signaling pathway
MAPK cascade
mitotic cell cycle
negative regulation of apoptotic process
negative regulation of canonical Wnt signaling pathway
negative regulation of inflammatory response to antigenic stimulus
negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
neurotrophin TRK receptor signaling pathway
NIK/NF-kappaB signaling
polyamine metabolic process
positive regulation of canonical Wnt signaling pathway
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
programmed cell death
protein polyubiquitination
Ras protein signal transduction
regulation of apoptotic process
regulation of cellular amino acid metabolic process
regulation of mRNA stability
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
small GTPase mediated signal transduction
small molecule metabolic process
stimulatory C-type lectin receptor signaling pathway
T cell receptor signaling pathway
tumor necrosis factor-mediated signaling pathway
vascular endothelial growth factor receptor signaling pathway
viral process - Gene Ontology Biological Process:
- activation of MAPKK activity
anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
apoptotic process
axon guidance
cellular nitrogen compound metabolic process
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
G1/S transition of mitotic cell cycle
gene expression
innate immune response
insulin receptor signaling pathway
MAPK cascade
mitotic cell cycle
negative regulation of apoptotic process
negative regulation of canonical Wnt signaling pathway
negative regulation of inflammatory response to antigenic stimulus
negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
neurotrophin TRK receptor signaling pathway
NIK/NF-kappaB signaling
polyamine metabolic process
positive regulation of canonical Wnt signaling pathway
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
programmed cell death
protein polyubiquitination
Ras protein signal transduction
regulation of apoptotic process
regulation of cellular amino acid metabolic process
regulation of mRNA stability
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
small GTPase mediated signal transduction
small molecule metabolic process
stimulatory C-type lectin receptor signaling pathway
T cell receptor signaling pathway
tumor necrosis factor-mediated signaling pathway
vascular endothelial growth factor receptor signaling pathway
viral process - Gene Ontology Molecular Function:
- lipopolysaccharide binding
threonine-type endopeptidase activity - Gene Ontology Cellular Component:
- cytosol
extracellular exosome
nucleoplasm
nucleus
proteasome complex
proteasome core complex - Keywords:
- 3D-structure
Acetylation
Complete proteome
Cytoplasm
Direct protein sequencing
Host-virus interaction
Hydrolase
Nucleus
Phosphoprotein
Polymorphism
Protease
Proteasome
Reference proteome
Threonine protease
Zymogen - Interacts With:
- A1L4K1; P25788