Names & Taxonomy
- Uniprot ID:
- P25774
- Entry Name:
- CATS_HUMAN
- Status:
- reviewed
- Protein Names:
- Cathepsin S (EC 3.4.22.27)
- Gene Names:
- CTSS
- Gene Names Primary:
- CTSS
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 331
- Sequence:
- MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Lysosome.
Function
- Function:
- Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.
- Catalytic Activity:
- Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.
- Active Site:
- ACT_SITE 139 139
- Gene Ontology Go:
- endolysosome lumen
extracellular region
extracellular space
intracellular membrane-bounded organelle
lysosomal lumen
lysosome
collagen binding
cysteine-type endopeptidase activity
fibronectin binding
laminin binding
proteoglycan binding
adaptive immune response
antigen processing and presentation
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent
antigen processing and presentation of exogenous peptide antigen via MHC class II
antigen processing and presentation of peptide antigen
antigen processing and presentation of peptide antigen via MHC class I
basement membrane disassembly
cellular response to thyroid hormone stimulus
collagen catabolic process
extracellular matrix disassembly
extracellular matrix organization
immune response
innate immune response
positive regulation of cation channel activity
protein processing
proteolysis
proteolysis involved in cellular protein catabolic process
response to acidic pH
toll-like receptor signaling pathway - Gene Ontology Biological Process:
- adaptive immune response
antigen processing and presentation
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent
antigen processing and presentation of exogenous peptide antigen via MHC class II
antigen processing and presentation of peptide antigen
antigen processing and presentation of peptide antigen via MHC class I
basement membrane disassembly
cellular response to thyroid hormone stimulus
collagen catabolic process
extracellular matrix disassembly
extracellular matrix organization
immune response
innate immune response
positive regulation of cation channel activity
protein processing
proteolysis
proteolysis involved in cellular protein catabolic process
response to acidic pH
toll-like receptor signaling pathway - Gene Ontology Molecular Function:
- collagen binding
cysteine-type endopeptidase activity
fibronectin binding
laminin binding
proteoglycan binding - Gene Ontology Cellular Component:
- endolysosome lumen
extracellular region
extracellular space
intracellular membrane-bounded organelle
lysosomal lumen
lysosome - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Disulfide bond
Glycoprotein
Hydrolase
Lysosome
Polymorphism
Protease
Reference proteome
Signal
Thiol protease
Zymogen