Names & Taxonomy
- Uniprot ID:
- P23297
- Entry Name:
- S10A1_HUMAN
- Status:
- reviewed
- Protein Names:
- Protein S100-A1 (S-100 protein alpha chain) (S-100 protein subunit alpha) (S100 calcium-binding protein A1)
- Gene Names:
- S100A1 S100A
- Gene Names Primary:
- S100A1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 94
- Sequence:
- MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm.
Function
- Function:
- Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
- Cross Reference Drug Bank:
- DB00768
- Gene Ontology Go:
- M band
neuron projection
nucleus
protein complex
sarcoplasmic reticulum
Z disc
ATPase binding
calcium ion binding
identical protein binding
protein homodimerization activity
S100 protein binding
intracellular signal transduction
negative regulation of transcription from RNA polymerase II promoter
positive regulation of voltage-gated calcium channel activity
regulation of heart contraction
substantia nigra development - Gene Ontology Biological Process:
- intracellular signal transduction
negative regulation of transcription from RNA polymerase II promoter
positive regulation of voltage-gated calcium channel activity
regulation of heart contraction
substantia nigra development - Gene Ontology Molecular Function:
- ATPase binding
calcium ion binding
identical protein binding
protein homodimerization activity
S100 protein binding - Gene Ontology Cellular Component:
- M band
neuron projection
nucleus
protein complex
sarcoplasmic reticulum
Z disc - Keywords:
- 3D-structure
Calcium
Complete proteome
Cytoplasm
Metal-binding
Reference proteome
Repeat
S-nitrosylation
Zinc - Interacts With:
- Itself; Q00987; Q9H8W4; P29034; P04271; P25815; P04637