Names & Taxonomy
- Uniprot ID:
- P21673
- Entry Name:
- SAT1_HUMAN
- Status:
- reviewed
- Protein Names:
- Diamine acetyltransferase 1 (EC 2.3.1.57) (Polyamine N-acetyltransferase 1) (Putrescine acetyltransferase) (Spermidine/spermine N(1)-acetyltransferase 1) (SSAT) (SSAT-1)
- Gene Names:
- SAT1 SAT
- Gene Names Primary:
- SAT1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 171
- Sequence:
- MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm.
Function
- Function:
- Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.
- Pathway:
- Amine and polyamine degradation; putrescine degradation; N-acetylputrescine from putrescine: step 1/1.
- Catalytic Activity:
- Acetyl-CoA + an alkane-alpha,omega-diamine = CoA + an N-acetyldiamine.
- Kinetics:
- BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=3.8 uM for acetyl-coenzyme A
- Cross Reference Drug Bank:
- DB00127
- Gene Ontology Go:
- cytosol
intracellular
diamine N-acetyltransferase activity
angiogenesis
cellular nitrogen compound metabolic process
polyamine biosynthetic process
polyamine metabolic process
putrescine catabolic process
regulation of cell proliferation
small molecule metabolic process - Gene Ontology Biological Process:
- angiogenesis
cellular nitrogen compound metabolic process
polyamine biosynthetic process
polyamine metabolic process
putrescine catabolic process
regulation of cell proliferation
small molecule metabolic process - Gene Ontology Molecular Function:
- diamine N-acetyltransferase activity
- Gene Ontology Cellular Component:
- cytosol
intracellular - Keywords:
- 3D-structure
Acyltransferase
Complete proteome
Cytoplasm
Direct protein sequencing
Reference proteome
Transferase - Interacts With:
- P17482; Q9BQ70