Names & Taxonomy
- Uniprot ID:
- P18510
- Entry Name:
- IL1RA_HUMAN
- Status:
- reviewed
- Protein Names:
- Interleukin-1 receptor antagonist protein (IL-1RN) (IL-1ra) (IRAP) (ICIL-1RA) (IL1 inhibitor) (Anakinra)
- Gene Names:
- IL1RN IL1F3 IL1RA
- Gene Names Primary:
- IL1RN
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 177
- Sequence:
- MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Isoform 1: Secreted.; Isoform 2: Cytoplasm.; Isoform 3: Cytoplasm.; Isoform 4: Cytoplasm.
Function
- Function:
- Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
- Cross Reference Drug Bank:
- DB06372
- Gene Ontology Go:
- cytoplasm
extracellular exosome
extracellular space
intracellular
plasma membrane
cytokine activity
interleukin-1 receptor antagonist activity
interleukin-1 receptor binding
interleukin-1 Type I receptor antagonist activity
interleukin-1 Type II receptor antagonist activity
interleukin-1, Type I receptor binding
interleukin-1, Type II receptor binding
acute-phase response
cytokine-mediated signaling pathway
fever generation
immune response
inflammatory response to antigenic stimulus
insulin secretion
lipid metabolic process
negative regulation of cytokine-mediated signaling pathway
negative regulation of heterotypic cell-cell adhesion
negative regulation of interleukin-1-mediated signaling pathway
response to glucocorticoid - Gene Ontology Biological Process:
- acute-phase response
cytokine-mediated signaling pathway
fever generation
immune response
inflammatory response to antigenic stimulus
insulin secretion
lipid metabolic process
negative regulation of cytokine-mediated signaling pathway
negative regulation of heterotypic cell-cell adhesion
negative regulation of interleukin-1-mediated signaling pathway
response to glucocorticoid - Gene Ontology Molecular Function:
- cytokine activity
interleukin-1, Type II receptor binding
interleukin-1, Type I receptor binding
interleukin-1 receptor antagonist activity
interleukin-1 receptor binding
interleukin-1 Type II receptor antagonist activity
interleukin-1 Type I receptor antagonist activity - Gene Ontology Cellular Component:
- cytoplasm
extracellular exosome
extracellular space
intracellular
plasma membrane - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Cytoplasm
Direct protein sequencing
Disulfide bond
Glycoprotein
Pharmaceutical
Polymorphism
Reference proteome
Secreted
Signal - Interacts With:
- Q9NYB0