Names & Taxonomy
- Uniprot ID:
- P18509
- Entry Name:
- PACA_HUMAN
- Status:
- reviewed
- Protein Names:
- Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into: PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38)]
- Gene Names:
- ADCYAP1
- Gene Names Primary:
- ADCYAP1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 176
- Sequence:
- MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development through the RAPGEF2/Rap1/B-Raf/ERK pathway.
- Gene Ontology Go:
- extracellular region
extracellular space
intracellular
terminal bouton
neuropeptide hormone activity
peptide hormone receptor binding
pituitary adenylate cyclase activating polypeptide activity
receptor binding
receptor signaling protein activity
activation of adenylate cyclase activity
ATP metabolic process
behavioral fear response
cAMP-mediated signaling
cell-cell signaling
cellular response to glucocorticoid stimulus
female pregnancy
histamine secretion
negative regulation of acute inflammatory response to antigenic stimulus
negative regulation of acute inflammatory response to non-antigenic stimulus
negative regulation of cell cycle
negative regulation of glial cell proliferation
negative regulation of GTPase activity
negative regulation of muscle cell apoptotic process
negative regulation of potassium ion transport
neuron projection development
neuropeptide signaling pathway
neurotrophin TRK receptor signaling pathway
ovarian follicle development
pituitary gland development
positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway
positive regulation of cell proliferation
positive regulation of chemokine (C-C motif) ligand 5 production
positive regulation of cytosolic calcium ion concentration
positive regulation of ERK1 and ERK2 cascade
positive regulation of growth hormone secretion
positive regulation of GTPase activity
positive regulation of interleukin-6 production
positive regulation of neuron projection development
positive regulation of protein kinase activity
positive regulation of somatostatin secretion
positive regulation of synaptic transmission, glutamatergic
positive regulation of transcription from RNA polymerase II promoter
positive regulation of vasodilation
regulation of G-protein coupled receptor protein signaling pathway
regulation of oligodendrocyte progenitor proliferation
regulation of postsynaptic membrane potential
regulation of protein localization
response to ethanol
response to starvation
sensory perception of pain
transmembrane receptor protein tyrosine kinase signaling pathway - Gene Ontology Biological Process:
- activation of adenylate cyclase activity
ATP metabolic process
behavioral fear response
cAMP-mediated signaling
cell-cell signaling
cellular response to glucocorticoid stimulus
female pregnancy
histamine secretion
negative regulation of acute inflammatory response to antigenic stimulus
negative regulation of acute inflammatory response to non-antigenic stimulus
negative regulation of cell cycle
negative regulation of glial cell proliferation
negative regulation of GTPase activity
negative regulation of muscle cell apoptotic process
negative regulation of potassium ion transport
neuron projection development
neuropeptide signaling pathway
neurotrophin TRK receptor signaling pathway
ovarian follicle development
pituitary gland development
positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway
positive regulation of cell proliferation
positive regulation of chemokine (C-C motif) ligand 5 production
positive regulation of cytosolic calcium ion concentration
positive regulation of ERK1 and ERK2 cascade
positive regulation of growth hormone secretion
positive regulation of GTPase activity
positive regulation of interleukin-6 production
positive regulation of neuron projection development
positive regulation of protein kinase activity
positive regulation of somatostatin secretion
positive regulation of synaptic transmission, glutamatergic
positive regulation of transcription from RNA polymerase II promoter
positive regulation of vasodilation
regulation of G-protein coupled receptor protein signaling pathway
regulation of oligodendrocyte progenitor proliferation
regulation of postsynaptic membrane potential
regulation of protein localization
response to ethanol
response to starvation
sensory perception of pain
transmembrane receptor protein tyrosine kinase signaling pathway - Gene Ontology Molecular Function:
- neuropeptide hormone activity
peptide hormone receptor binding
pituitary adenylate cyclase activating polypeptide activity
receptor binding
receptor signaling protein activity - Gene Ontology Cellular Component:
- extracellular region
extracellular space
intracellular
terminal bouton - Keywords:
- 3D-structure
Amidation
Cleavage on pair of basic residues
Complete proteome
Hormone
Neurogenesis
Polymorphism
Reference proteome
Secreted
Signal - Interacts With:
- P10909