Names & Taxonomy
- Uniprot ID:
- P18089
- Entry Name:
- ADA2B_HUMAN
- Status:
- reviewed
- Protein Names:
- Alpha-2B adrenergic receptor (Alpha-2 adrenergic receptor subtype C2) (Alpha-2B adrenoreceptor) (Alpha-2B adrenoceptor) (Alpha-2BAR)
- Gene Names:
- ADRA2B ADRA2L1 ADRA2RL1
- Gene Names Primary:
- ADRA2B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 447
- Sequence:
- MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRPWTQTAW
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol.
- Cross Reference Drug Bank:
- DB00543 DB00182 DB00714 DB00964 DB01238 DB06216 DB00217 DB00484 DB01200 DB00248 DB01136 DB00477 DB00575 DB00363 DB01151 DB01142 DB04855 DB06262 DB01363 DB00668 DB01049 DB00696 DB00292 DB00800 DB00629 DB01018 DB00589 DB00408 DB00934 DB01365 DB01577 DB01403 DB06148 DB00368 DB00540 DB00334 DB00935 DB01267 DB01186 DB00925 DB00413 DB00457 DB01224 DB00734 DB00268 DB05271 DB00697 DB00797 DB00726 DB06694 DB01392 DB00246
- Gene Ontology Go:
- integral component of plasma membrane
plasma membrane
alpha2-adrenergic receptor activity
epinephrine binding
activation of MAPK activity by adrenergic receptor signaling pathway
activation of protein kinase B activity
adenylate cyclase-activating adrenergic receptor signaling pathway
blood coagulation
cell-cell signaling
epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway
G-protein coupled receptor signaling pathway
negative regulation of epinephrine secretion
negative regulation of norepinephrine secretion
platelet activation
positive regulation of neuron differentiation
regulation of smooth muscle contraction
regulation of vasoconstriction - Gene Ontology Biological Process:
- activation of MAPK activity by adrenergic receptor signaling pathway
activation of protein kinase B activity
adenylate cyclase-activating adrenergic receptor signaling pathway
blood coagulation
cell-cell signaling
epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway
G-protein coupled receptor signaling pathway
negative regulation of epinephrine secretion
negative regulation of norepinephrine secretion
platelet activation
positive regulation of neuron differentiation
regulation of smooth muscle contraction
regulation of vasoconstriction - Gene Ontology Molecular Function:
- alpha2-adrenergic receptor activity
epinephrine binding - Gene Ontology Cellular Component:
- integral component of plasma membrane
plasma membrane - Keywords:
- 3D-structure
Cell membrane
Complete proteome
Disulfide bond
Epilepsy
G-protein coupled receptor
Lipoprotein
Membrane
Palmitate
Polymorphism
Receptor
Reference proteome
Transducer
Transmembrane
Transmembrane helix - Interacts With:
- Q9ULW5