Names & Taxonomy
- Uniprot ID:
- P18085
- Entry Name:
- ARF4_HUMAN
- Status:
- reviewed
- Protein Names:
- ADP-ribosylation factor 4
- Gene Names:
- ARF4 ARF2
- Gene Names Primary:
- ARF4
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 180
- Sequence:
- MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Golgi apparatus. Membrane
Function
- Function:
- GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
- Gene Ontology Go:
- cytosol
dendritic spine
extracellular exosome
Golgi apparatus
membrane
ruffle membrane
epidermal growth factor receptor binding
GTP binding
GTPase activity
activation of phospholipase D activity
apical protein localization
brain development
cell migration
cellular protein metabolic process
dendritic spine development
epidermal growth factor receptor signaling pathway
ER to Golgi vesicle-mediated transport
establishment or maintenance of epithelial cell apical/basal polarity
learning
membrane organization
negative regulation of apoptotic process
organelle organization
positive regulation of transcription from RNA polymerase II promoter
post-translational protein modification
protein ADP-ribosylation
protein localization to cilium
protein N-linked glycosylation via asparagine
protein transport
regulation of reactive oxygen species metabolic process
response to axon injury
small GTPase mediated signal transduction - Gene Ontology Biological Process:
- activation of phospholipase D activity
apical protein localization
brain development
cell migration
cellular protein metabolic process
dendritic spine development
epidermal growth factor receptor signaling pathway
ER to Golgi vesicle-mediated transport
establishment or maintenance of epithelial cell apical/basal polarity
learning
membrane organization
negative regulation of apoptotic process
organelle organization
positive regulation of transcription from RNA polymerase II promoter
post-translational protein modification
protein ADP-ribosylation
protein localization to cilium
protein N-linked glycosylation via asparagine
protein transport
regulation of reactive oxygen species metabolic process
response to axon injury
small GTPase mediated signal transduction - Gene Ontology Molecular Function:
- epidermal growth factor receptor binding
GTPase activity
GTP binding - Gene Ontology Cellular Component:
- cytosol
dendritic spine
extracellular exosome
Golgi apparatus
membrane
ruffle membrane - Keywords:
- 3D-structure
Complete proteome
ER-Golgi transport
GTP-binding
Golgi apparatus
Lipoprotein
Membrane
Myristate
Nucleotide-binding
Polymorphism
Protein transport
Reference proteome
Transport - Interacts With:
- Q96PM5; Q9H190