Names & Taxonomy
- Uniprot ID:
- P18031
- Entry Name:
- PTN1_HUMAN
- Status:
- reviewed
- Protein Names:
- Tyrosine-protein phosphatase non-receptor type 1 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B)
- Gene Names:
- PTPN1 PTP1B
- Gene Names Primary:
- PTPN1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 435
- Sequence:
- MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Endoplasmic reticulum membrane
Function
- Function:
- Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET.
- Catalytic Activity:
- Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.
- Active Site:
- ACT_SITE 215 215 Phosphocysteine intermediate.
- Cross Reference Drug Bank:
- DB01133
- Gene Ontology Go:
- cytoplasmic side of endoplasmic reticulum membrane
cytoplasmic vesicle
cytosol
early endosome
endoplasmic reticulum
sorting endosome
enzyme binding
ephrin receptor binding
poly(A) RNA binding
protein kinase binding
protein tyrosine phosphatase activity
receptor tyrosine kinase binding
zinc ion binding
actin cytoskeleton reorganization
activation of JUN kinase activity
activation of signaling protein activity involved in unfolded protein response
blood coagulation
cytokine-mediated signaling pathway
endoplasmic reticulum unfolded protein response
insulin receptor signaling pathway
interferon-gamma-mediated signaling pathway
IRE1-mediated unfolded protein response
JAK-STAT cascade involved in growth hormone signaling pathway
negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
negative regulation of ERK1 and ERK2 cascade
negative regulation of insulin receptor signaling pathway
negative regulation of MAP kinase activity
negative regulation of PERK-mediated unfolded protein response
negative regulation of vascular endothelial growth factor receptor signaling pathway
peptidyl-tyrosine dephosphorylation
peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity
platelet activation
platelet-derived growth factor receptor-beta signaling pathway
positive regulation of IRE1-mediated unfolded protein response
positive regulation of protein tyrosine kinase activity
positive regulation of receptor catabolic process
protein dephosphorylation
regulation of endocytosis
regulation of hepatocyte growth factor receptor signaling pathway
regulation of interferon-gamma-mediated signaling pathway
regulation of intracellular protein transport
regulation of signal transduction
regulation of type I interferon-mediated signaling pathway
type I interferon signaling pathway - Gene Ontology Biological Process:
- actin cytoskeleton reorganization
activation of JUN kinase activity
activation of signaling protein activity involved in unfolded protein response
blood coagulation
cytokine-mediated signaling pathway
endoplasmic reticulum unfolded protein response
insulin receptor signaling pathway
interferon-gamma-mediated signaling pathway
IRE1-mediated unfolded protein response
JAK-STAT cascade involved in growth hormone signaling pathway
negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
negative regulation of ERK1 and ERK2 cascade
negative regulation of insulin receptor signaling pathway
negative regulation of MAP kinase activity
negative regulation of PERK-mediated unfolded protein response
negative regulation of vascular endothelial growth factor receptor signaling pathway
peptidyl-tyrosine dephosphorylation
peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity
platelet activation
platelet-derived growth factor receptor-beta signaling pathway
positive regulation of IRE1-mediated unfolded protein response
positive regulation of protein tyrosine kinase activity
positive regulation of receptor catabolic process
protein dephosphorylation
regulation of endocytosis
regulation of hepatocyte growth factor receptor signaling pathway
regulation of interferon-gamma-mediated signaling pathway
regulation of intracellular protein transport
regulation of signal transduction
regulation of type I interferon-mediated signaling pathway
type I interferon signaling pathway - Gene Ontology Molecular Function:
- enzyme binding
ephrin receptor binding
poly(A) RNA binding
protein kinase binding
protein tyrosine phosphatase activity
receptor tyrosine kinase binding
zinc ion binding - Gene Ontology Cellular Component:
- cytoplasmic side of endoplasmic reticulum membrane
cytoplasmic vesicle
cytosol
early endosome
endoplasmic reticulum
sorting endosome - Keywords:
- 3D-structure
Acetylation
Complete proteome
Direct protein sequencing
Endoplasmic reticulum
Hydrolase
Membrane
Oxidation
Phosphoprotein
Polymorphism
Protein phosphatase
Reference proteome
S-nitrosylation - Interacts With:
- P56945; Q61140; Q63767; P11274-1; P07384; Q03135; P15116; Q63768; Q14247; P00533; P19235; P10912; P62993; P62994; P08069; P06213; P35570; P05556; P05106; O60674; O43561; P08581; P04629; P09619; P05622; P10686; P34152; Q8VI36; Q96TC7; P08922; P12931; P40763; P42229; P63166; Q9H1D0; P10599