Names & Taxonomy
- Uniprot ID:
- P15382
- Entry Name:
- KCNE1_HUMAN
- Status:
- reviewed
- Protein Names:
- Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel)
- Gene Names:
- KCNE1
- Gene Names Primary:
- KCNE1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 129
- Sequence:
- MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 (PubMed:19219384). Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).
- Cross Reference Drug Bank:
- DB00808
- Gene Ontology Go:
- apical plasma membrane
cell surface
lysosome
membrane raft
plasma membrane
voltage-gated potassium channel complex
Z disc
delayed rectifier potassium channel activity
potassium channel regulator activity
telethonin binding
cardiac conduction
cardiac muscle cell action potential involved in contraction
cellular response to cAMP
membrane repolarization
membrane repolarization during action potential
membrane repolarization during cardiac muscle cell action potential
negative regulation of delayed rectifier potassium channel activity
negative regulation of protein targeting to membrane
positive regulation of potassium ion transmembrane transport
potassium ion export
potassium ion transmembrane transport
protein N-linked glycosylation
protein O-linked glycosylation
regulation of delayed rectifier potassium channel activity
regulation of heart rate by cardiac conduction
regulation of potassium ion transmembrane transport
regulation of ventricular cardiac muscle cell membrane repolarization
sensory perception of sound
ventricular cardiac muscle cell action potential - Gene Ontology Biological Process:
- cardiac conduction
cardiac muscle cell action potential involved in contraction
cellular response to cAMP
membrane repolarization
membrane repolarization during action potential
membrane repolarization during cardiac muscle cell action potential
negative regulation of delayed rectifier potassium channel activity
negative regulation of protein targeting to membrane
positive regulation of potassium ion transmembrane transport
potassium ion export
potassium ion transmembrane transport
protein N-linked glycosylation
protein O-linked glycosylation
regulation of delayed rectifier potassium channel activity
regulation of heart rate by cardiac conduction
regulation of potassium ion transmembrane transport
regulation of ventricular cardiac muscle cell membrane repolarization
sensory perception of sound
ventricular cardiac muscle cell action potential - Gene Ontology Molecular Function:
- delayed rectifier potassium channel activity
potassium channel regulator activity
telethonin binding - Gene Ontology Cellular Component:
- apical plasma membrane
cell surface
lysosome
membrane raft
plasma membrane
voltage-gated potassium channel complex
Z disc - Keywords:
- 3D-structure
Cell membrane
Complete proteome
Deafness
Disease mutation
Glycoprotein
Ion channel
Ion transport
Long QT syndrome
Membrane
Phosphoprotein
Polymorphism
Potassium
Potassium channel
Potassium transport
Reference proteome
Transmembrane
Transmembrane helix
Transport
Voltage-gated channel - Interacts With:
- P51787; A6HIS0