Names & Taxonomy
- Uniprot ID:
- P14854
- Entry Name:
- CX6B1_HUMAN
- Status:
- reviewed
- Protein Names:
- Cytochrome c oxidase subunit 6B1 (Cytochrome c oxidase subunit VIb isoform 1) (COX VIb-1)
- Gene Names:
- COX6B1 COX6B
- Gene Names Primary:
- COX6B1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 86
- Sequence:
- MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Mitochondrion intermembrane space
Function
- Function:
- Connects the two COX monomers into the physiological dimeric form.
- Cross Reference Drug Bank:
- DB02659
- Gene Ontology Go:
- mitochondrial inner membrane
mitochondrial intermembrane space
mitochondrion
cytochrome-c oxidase activity
cellular metabolic process
gene expression
hydrogen ion transmembrane transport
respiratory electron transport chain
small molecule metabolic process
substantia nigra development
transcription initiation from RNA polymerase II promoter - Gene Ontology Biological Process:
- cellular metabolic process
gene expression
hydrogen ion transmembrane transport
respiratory electron transport chain
small molecule metabolic process
substantia nigra development
transcription initiation from RNA polymerase II promoter - Gene Ontology Molecular Function:
- cytochrome-c oxidase activity
- Gene Ontology Cellular Component:
- mitochondrial inner membrane
mitochondrial intermembrane space
mitochondrion - Keywords:
- Acetylation
Complete proteome
Disease mutation
Disulfide bond
Mitochondrion
Reference proteome