Names & Taxonomy
- Uniprot ID:
- P14416
- Entry Name:
- DRD2_HUMAN
- Status:
- reviewed
- Protein Names:
- D(2) dopamine receptor (Dopamine D2 receptor)
- Gene Names:
- DRD2
- Gene Names Primary:
- DRD2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 443
- Sequence:
- MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
- Cross Reference Drug Bank:
- DB01614 DB01063 DB01425 DB00915 DB06288 DB00543 DB00182 DB00714 DB01238 DB06216 DB09128 DB01200 DB09018 DB00490 DB00248 DB06016 DB00477 DB01239 DB00568 DB00363 DB01151 DB01184 DB00988 DB01142 DB00450 DB01049 DB00696 DB00875 DB00623 DB04842 DB00502 DB04946 DB00458 DB01221 DB01235 DB00589 DB00408 DB08815 DB00934 DB01043 DB00933 DB01403 DB01233 DB06148 DB00805 DB00370 DB01618 DB00540 DB00334 DB01267 DB01186 DB00850 DB01100 DB01621 DB00413 DB00433 DB00420 DB01069 DB00777 DB01224 DB00409 DB00734 DB00268 DB05271 DB06144 DB00391 DB04844 DB01622 DB00679 DB01623 DB00831 DB00508 DB00726 DB01392 DB00246 DB01624
- Gene Ontology Go:
- acrosomal vesicle
axon
axon terminus
ciliary membrane
cytosol
dendrite
dendritic spine
endocytic vesicle
integral component of plasma membrane
intracellular
lateral plasma membrane
nonmotile primary cilium
perikaryon
plasma membrane
postsynaptic density
sperm flagellum
synaptic vesicle membrane
dopamine binding
dopamine neurotransmitter receptor activity, coupled via Gi/Go
drug binding
identical protein binding
potassium channel regulator activity
activation of protein kinase activity
adenohypophysis development
adenylate cyclase-inhibiting dopamine receptor signaling pathway
adult walking behavior
arachidonic acid secretion
associative learning
auditory behavior
axonogenesis
behavioral response to cocaine
behavioral response to ethanol
branching morphogenesis of a nerve
cellular calcium ion homeostasis
cerebral cortex GABAergic interneuron migration
chemical synaptic transmission, postsynaptic
circadian regulation of gene expression
dopamine metabolic process
feeding behavior
G-protein coupled receptor internalization
grooming behavior
intracellular signal transduction
locomotory behavior
long-term memory
negative regulation of adenylate cyclase activity
negative regulation of blood pressure
negative regulation of cell migration
negative regulation of cell proliferation
negative regulation of circadian sleep/wake cycle, sleep
negative regulation of cytosolic calcium ion concentration
negative regulation of dopamine receptor signaling pathway
negative regulation of dopamine secretion
negative regulation of innate immune response
negative regulation of insulin secretion
negative regulation of protein kinase B signaling
negative regulation of protein secretion
negative regulation of synaptic transmission, glutamatergic
negative regulation of voltage-gated calcium channel activity
neurological system process involved in regulation of systemic arterial blood pressure
neuron-neuron synaptic transmission
orbitofrontal cortex development
peristalsis
phosphatidylinositol metabolic process
phospholipase C-activating dopamine receptor signaling pathway
pigmentation
positive regulation of cytokinesis
positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
positive regulation of dopamine uptake involved in synaptic transmission
positive regulation of ERK1 and ERK2 cascade
positive regulation of G-protein coupled receptor protein signaling pathway
positive regulation of glial cell-derived neurotrophic factor secretion
positive regulation of growth hormone secretion
positive regulation of long-term synaptic potentiation
positive regulation of multicellular organism growth
positive regulation of neuroblast proliferation
positive regulation of receptor internalization
positive regulation of renal sodium excretion
positive regulation of transcription from RNA polymerase II promoter
positive regulation of urine volume
prepulse inhibition
protein localization
regulation of cAMP metabolic process
regulation of dopamine secretion
regulation of dopamine uptake involved in synaptic transmission
regulation of heart rate
regulation of locomotion involved in locomotory behavior
regulation of long-term neuronal synaptic plasticity
regulation of phosphoprotein phosphatase activity
regulation of potassium ion transport
regulation of sodium ion transport
regulation of synapse structural plasticity
regulation of synaptic transmission, GABAergic
release of sequestered calcium ion into cytosol
response to amphetamine
response to axon injury
response to cocaine
response to drug
response to histamine
response to hypoxia
response to inactivity
response to iron ion
response to light stimulus
response to morphine
response to nicotine
response to toxic substance
sensory perception of smell
striatum development
synapse assembly
synaptic transmission, dopaminergic
temperature homeostasis
visual learning
Wnt signaling pathway - Gene Ontology Biological Process:
- activation of protein kinase activity
adenohypophysis development
adenylate cyclase-inhibiting dopamine receptor signaling pathway
adult walking behavior
arachidonic acid secretion
associative learning
auditory behavior
axonogenesis
behavioral response to cocaine
behavioral response to ethanol
branching morphogenesis of a nerve
cellular calcium ion homeostasis
cerebral cortex GABAergic interneuron migration
chemical synaptic transmission, postsynaptic
circadian regulation of gene expression
dopamine metabolic process
feeding behavior
G-protein coupled receptor internalization
grooming behavior
intracellular signal transduction
locomotory behavior
long-term memory
negative regulation of adenylate cyclase activity
negative regulation of blood pressure
negative regulation of cell migration
negative regulation of cell proliferation
negative regulation of circadian sleep/wake cycle, sleep
negative regulation of cytosolic calcium ion concentration
negative regulation of dopamine receptor signaling pathway
negative regulation of dopamine secretion
negative regulation of innate immune response
negative regulation of insulin secretion
negative regulation of protein kinase B signaling
negative regulation of protein secretion
negative regulation of synaptic transmission, glutamatergic
negative regulation of voltage-gated calcium channel activity
neurological system process involved in regulation of systemic arterial blood pressure
neuron-neuron synaptic transmission
orbitofrontal cortex development
peristalsis
phosphatidylinositol metabolic process
phospholipase C-activating dopamine receptor signaling pathway
pigmentation
positive regulation of cytokinesis
positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
positive regulation of dopamine uptake involved in synaptic transmission
positive regulation of ERK1 and ERK2 cascade
positive regulation of glial cell-derived neurotrophic factor secretion
positive regulation of G-protein coupled receptor protein signaling pathway
positive regulation of growth hormone secretion
positive regulation of long-term synaptic potentiation
positive regulation of multicellular organism growth
positive regulation of neuroblast proliferation
positive regulation of receptor internalization
positive regulation of renal sodium excretion
positive regulation of transcription from RNA polymerase II promoter
positive regulation of urine volume
prepulse inhibition
protein localization
regulation of cAMP metabolic process
regulation of dopamine secretion
regulation of dopamine uptake involved in synaptic transmission
regulation of heart rate
regulation of locomotion involved in locomotory behavior
regulation of long-term neuronal synaptic plasticity
regulation of phosphoprotein phosphatase activity
regulation of potassium ion transport
regulation of sodium ion transport
regulation of synapse structural plasticity
regulation of synaptic transmission, GABAergic
release of sequestered calcium ion into cytosol
response to amphetamine
response to axon injury
response to cocaine
response to drug
response to histamine
response to hypoxia
response to inactivity
response to iron ion
response to light stimulus
response to morphine
response to nicotine
response to toxic substance
sensory perception of smell
striatum development
synapse assembly
synaptic transmission, dopaminergic
temperature homeostasis
visual learning
Wnt signaling pathway - Gene Ontology Molecular Function:
- dopamine binding
dopamine neurotransmitter receptor activity, coupled via Gi/Go
drug binding
identical protein binding
potassium channel regulator activity - Gene Ontology Cellular Component:
- acrosomal vesicle
axon
axon terminus
ciliary membrane
cytosol
dendrite
dendritic spine
endocytic vesicle
integral component of plasma membrane
intracellular
lateral plasma membrane
nonmotile primary cilium
perikaryon
plasma membrane
postsynaptic density
sperm flagellum
synaptic vesicle membrane - Keywords:
- 3D-structure
Alternative splicing
Cell membrane
Complete proteome
Disease mutation
Disulfide bond
G-protein coupled receptor
Glycoprotein
Membrane
Polymorphism
Receptor
Reference proteome
Transducer
Transmembrane
Transmembrane helix - Interacts With:
- Itself; P29274; Q01959