Names & Taxonomy
- Uniprot ID:
- P13501
- Entry Name:
- CCL5_HUMAN
- Status:
- reviewed
- Protein Names:
- C-C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS-delta) (Small-inducible cytokine A5) (T cell-specific protein P228) (TCP228) (T-cell-specific protein RANTES) [Cleaved into: RANTES(3-68); RANTES(4-68)]
- Gene Names:
- CCL5 D17S136E SCYA5
- Gene Names Primary:
- CCL5
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 91
- Sequence:
- MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils (PubMed:16791620, PubMed:1380064, PubMed:8525373, PubMed:9516414, PubMed:15923218). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485).
- Gene Ontology Go:
- cytoplasm
extracellular region
extracellular space
CCR1 chemokine receptor binding
CCR4 chemokine receptor binding
CCR5 chemokine receptor binding
chemoattractant activity
chemokine activity
chemokine receptor antagonist activity
chemokine receptor binding
heparin binding
phosphatidylinositol phospholipase C activity
phospholipase activator activity
protein homodimerization activity
protein kinase activity
protein self-association
receptor signaling protein tyrosine kinase activator activity
activation of phospholipase D activity
aging
calcium ion transport
cell-cell signaling
cellular calcium ion homeostasis
cellular protein complex assembly
cellular response to alkyl hydroperoxide
cellular response to amino acid stimulus
cellular response to ethanol
cellular response to fibroblast growth factor stimulus
cellular response to high density lipoprotein particle stimulus
cellular response to interferon-gamma
cellular response to interleukin-1
cellular response to morphine
cellular response to organic cyclic compound
cellular response to transforming growth factor beta stimulus
cellular response to tumor necrosis factor
cellular response to vitamin K
chemokine-mediated signaling pathway
chemotaxis
chronic inflammatory response
dendritic cell chemotaxis
dibenzo-p-dioxin metabolic process
eosinophil chemotaxis
exocytosis
G-protein coupled receptor signaling pathway
inflammatory response
leukocyte cell-cell adhesion
lipopolysaccharide-mediated signaling pathway
lymphocyte chemotaxis
macrophage chemotaxis
MAPK cascade
monocyte chemotaxis
negative regulation by host of viral transcription
negative regulation of chemokine-mediated signaling pathway
negative regulation of G-protein coupled receptor protein signaling pathway
negative regulation of macrophage apoptotic process
negative regulation of neuron death
negative regulation of T cell apoptotic process
negative regulation of viral genome replication
neutrophil activation
neutrophil chemotaxis
positive chemotaxis
positive regulation of activation of JAK2 kinase activity
positive regulation of angiogenesis
positive regulation of calcium ion transport
positive regulation of cell adhesion
positive regulation of cell migration
positive regulation of cell-cell adhesion mediated by integrin
positive regulation of cellular biosynthetic process
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of fever generation
positive regulation of GTPase activity
positive regulation of homotypic cell-cell adhesion
positive regulation of inflammatory response
positive regulation of innate immune response
positive regulation of JAK-STAT cascade
positive regulation of macrophage chemotaxis
positive regulation of mast cell chemotaxis
positive regulation of monocyte chemotaxis
positive regulation of natural killer cell chemotaxis
positive regulation of neuron differentiation
positive regulation of osteoclast differentiation
positive regulation of phosphatidylinositol 3-kinase signaling
positive regulation of phosphorylation
positive regulation of protein tyrosine kinase activity
positive regulation of smooth muscle cell migration
positive regulation of smooth muscle cell proliferation
positive regulation of T cell apoptotic process
positive regulation of T cell chemotaxis
positive regulation of T cell migration
positive regulation of T cell proliferation
positive regulation of translational initiation
positive regulation of tyrosine phosphorylation of STAT protein
positive regulation of viral genome replication
protein kinase B signaling
protein tetramerization
regulation of chronic inflammatory response
regulation of insulin secretion
regulation of neuron death
regulation of T cell activation
response to activity
response to cholesterol
response to drug
response to estrogen
response to glucocorticoid
response to insulin
response to salt stress
response to toxic substance
response to virus - Gene Ontology Biological Process:
- activation of phospholipase D activity
aging
calcium ion transport
cell-cell signaling
cellular calcium ion homeostasis
cellular protein complex assembly
cellular response to alkyl hydroperoxide
cellular response to amino acid stimulus
cellular response to ethanol
cellular response to fibroblast growth factor stimulus
cellular response to high density lipoprotein particle stimulus
cellular response to interferon-gamma
cellular response to interleukin-1
cellular response to morphine
cellular response to organic cyclic compound
cellular response to transforming growth factor beta stimulus
cellular response to tumor necrosis factor
cellular response to vitamin K
chemokine-mediated signaling pathway
chemotaxis
chronic inflammatory response
dendritic cell chemotaxis
dibenzo-p-dioxin metabolic process
eosinophil chemotaxis
exocytosis
G-protein coupled receptor signaling pathway
inflammatory response
leukocyte cell-cell adhesion
lipopolysaccharide-mediated signaling pathway
lymphocyte chemotaxis
macrophage chemotaxis
MAPK cascade
monocyte chemotaxis
negative regulation by host of viral transcription
negative regulation of chemokine-mediated signaling pathway
negative regulation of G-protein coupled receptor protein signaling pathway
negative regulation of macrophage apoptotic process
negative regulation of neuron death
negative regulation of T cell apoptotic process
negative regulation of viral genome replication
neutrophil activation
neutrophil chemotaxis
positive chemotaxis
positive regulation of activation of JAK2 kinase activity
positive regulation of angiogenesis
positive regulation of calcium ion transport
positive regulation of cell adhesion
positive regulation of cell-cell adhesion mediated by integrin
positive regulation of cell migration
positive regulation of cellular biosynthetic process
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of fever generation
positive regulation of GTPase activity
positive regulation of homotypic cell-cell adhesion
positive regulation of inflammatory response
positive regulation of innate immune response
positive regulation of JAK-STAT cascade
positive regulation of macrophage chemotaxis
positive regulation of mast cell chemotaxis
positive regulation of monocyte chemotaxis
positive regulation of natural killer cell chemotaxis
positive regulation of neuron differentiation
positive regulation of osteoclast differentiation
positive regulation of phosphatidylinositol 3-kinase signaling
positive regulation of phosphorylation
positive regulation of protein tyrosine kinase activity
positive regulation of smooth muscle cell migration
positive regulation of smooth muscle cell proliferation
positive regulation of T cell apoptotic process
positive regulation of T cell chemotaxis
positive regulation of T cell migration
positive regulation of T cell proliferation
positive regulation of translational initiation
positive regulation of tyrosine phosphorylation of STAT protein
positive regulation of viral genome replication
protein kinase B signaling
protein tetramerization
regulation of chronic inflammatory response
regulation of insulin secretion
regulation of neuron death
regulation of T cell activation
response to activity
response to cholesterol
response to drug
response to estrogen
response to glucocorticoid
response to insulin
response to salt stress
response to toxic substance
response to virus - Gene Ontology Molecular Function:
- CCR1 chemokine receptor binding
CCR4 chemokine receptor binding
CCR5 chemokine receptor binding
chemoattractant activity
chemokine activity
chemokine receptor antagonist activity
chemokine receptor binding
heparin binding
phosphatidylinositol phospholipase C activity
phospholipase activator activity
protein homodimerization activity
protein kinase activity
protein self-association
receptor signaling protein tyrosine kinase activator activity - Gene Ontology Cellular Component:
- cytoplasm
extracellular region
extracellular space - Keywords:
- 3D-structure
Chemotaxis
Complete proteome
Cytokine
Direct protein sequencing
Disulfide bond
Glycoprotein
Inflammatory response
Oxidation
Polymorphism
Reference proteome
Secreted
Signal - Interacts With:
- P51681