Names & Taxonomy
- Uniprot ID:
- P10415
- Entry Name:
- BCL2_HUMAN
- Status:
- reviewed
- Protein Names:
- Apoptosis regulator Bcl-2
- Gene Names:
- BCL2
- Gene Names Primary:
- BCL2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 239
- Sequence:
- MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Mitochondrion outer membrane
Function
- Function:
- Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).
- Cross Reference Drug Bank:
- DB01248 DB01050 DB01229 DB01367
- Gene Ontology Go:
- cytoplasm
cytosol
endoplasmic reticulum
endoplasmic reticulum membrane
membrane
mitochondrial outer membrane
mitochondrion
myelin sheath
nuclear membrane
nucleus
pore complex
BH3 domain binding
channel activity
channel inhibitor activity
identical protein binding
protease binding
protein heterodimerization activity
protein homodimerization activity
sequence-specific DNA binding
ubiquitin protein ligase binding
actin filament organization
apoptotic process
axon regeneration
axonogenesis
B cell homeostasis
B cell lineage commitment
B cell proliferation
B cell receptor signaling pathway
behavioral fear response
branching involved in ureteric bud morphogenesis
CD8-positive, alpha-beta T cell lineage commitment
cell aging
cell growth
cellular response to DNA damage stimulus
cellular response to glucose starvation
cellular response to hypoxia
cellular response to organic substance
cochlear nucleus development
defense response to virus
digestive tract morphogenesis
ear development
endoplasmic reticulum calcium ion homeostasis
extrinsic apoptotic signaling pathway in absence of ligand
extrinsic apoptotic signaling pathway via death domain receptors
female pregnancy
focal adhesion assembly
gland morphogenesis
glomerulus development
hair follicle morphogenesis
homeostasis of number of cells within a tissue
humoral immune response
innate immune response
intrinsic apoptotic signaling pathway
intrinsic apoptotic signaling pathway in response to DNA damage
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
intrinsic apoptotic signaling pathway in response to oxidative stress
lymphoid progenitor cell differentiation
male gonad development
melanin metabolic process
melanocyte differentiation
mesenchymal cell development
metanephros development
negative regulation of anoikis
negative regulation of apoptotic process
negative regulation of apoptotic signaling pathway
negative regulation of autophagy
negative regulation of calcium ion transport into cytosol
negative regulation of cell growth
negative regulation of cell migration
negative regulation of cellular pH reduction
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of G1/S transition of mitotic cell cycle
negative regulation of intrinsic apoptotic signaling pathway
negative regulation of mitochondrial depolarization
negative regulation of myeloid cell apoptotic process
negative regulation of neuron apoptotic process
negative regulation of ossification
negative regulation of osteoblast proliferation
negative regulation of reactive oxygen species metabolic process
negative regulation of retinal cell programmed cell death
neuron apoptotic process
nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway
oocyte development
organ growth
ossification
ovarian follicle development
peptidyl-serine phosphorylation
peptidyl-threonine phosphorylation
pigment granule organization
positive regulation of B cell proliferation
positive regulation of catalytic activity
positive regulation of cell growth
positive regulation of intrinsic apoptotic signaling pathway
positive regulation of melanocyte differentiation
positive regulation of multicellular organism growth
positive regulation of neuron maturation
positive regulation of peptidyl-serine phosphorylation
positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
positive regulation of skeletal muscle fiber development
positive regulation of smooth muscle cell migration
post-embryonic development
programmed cell death
protein dephosphorylation
protein polyubiquitination
reactive oxygen species metabolic process
regulation of calcium ion transport
regulation of cell-matrix adhesion
regulation of gene expression
regulation of glycoprotein biosynthetic process
regulation of mitochondrial membrane permeability
regulation of mitochondrial membrane potential
regulation of nitrogen utilization
regulation of protein heterodimerization activity
regulation of protein homodimerization activity
regulation of protein stability
regulation of transmembrane transporter activity
regulation of viral genome replication
release of cytochrome c from mitochondria
renal system process
response to cytokine
response to drug
response to gamma radiation
response to glucocorticoid
response to hydrogen peroxide
response to iron ion
response to ischemia
response to nicotine
response to radiation
response to toxic substance
response to UV-B
spleen development
T cell differentiation in thymus
T cell homeostasis
thymus development
transmembrane transport - Gene Ontology Biological Process:
- actin filament organization
apoptotic process
axonogenesis
axon regeneration
B cell homeostasis
B cell lineage commitment
B cell proliferation
B cell receptor signaling pathway
behavioral fear response
branching involved in ureteric bud morphogenesis
CD8-positive, alpha-beta T cell lineage commitment
cell aging
cell growth
cellular response to DNA damage stimulus
cellular response to glucose starvation
cellular response to hypoxia
cellular response to organic substance
cochlear nucleus development
defense response to virus
digestive tract morphogenesis
ear development
endoplasmic reticulum calcium ion homeostasis
extrinsic apoptotic signaling pathway in absence of ligand
extrinsic apoptotic signaling pathway via death domain receptors
female pregnancy
focal adhesion assembly
gland morphogenesis
glomerulus development
hair follicle morphogenesis
homeostasis of number of cells within a tissue
humoral immune response
innate immune response
intrinsic apoptotic signaling pathway
intrinsic apoptotic signaling pathway in response to DNA damage
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
intrinsic apoptotic signaling pathway in response to oxidative stress
lymphoid progenitor cell differentiation
male gonad development
melanin metabolic process
melanocyte differentiation
mesenchymal cell development
metanephros development
negative regulation of anoikis
negative regulation of apoptotic process
negative regulation of apoptotic signaling pathway
negative regulation of autophagy
negative regulation of calcium ion transport into cytosol
negative regulation of cell growth
negative regulation of cell migration
negative regulation of cellular pH reduction
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of G1/S transition of mitotic cell cycle
negative regulation of intrinsic apoptotic signaling pathway
negative regulation of mitochondrial depolarization
negative regulation of myeloid cell apoptotic process
negative regulation of neuron apoptotic process
negative regulation of ossification
negative regulation of osteoblast proliferation
negative regulation of reactive oxygen species metabolic process
negative regulation of retinal cell programmed cell death
neuron apoptotic process
nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway
oocyte development
organ growth
ossification
ovarian follicle development
peptidyl-serine phosphorylation
peptidyl-threonine phosphorylation
pigment granule organization
positive regulation of B cell proliferation
positive regulation of catalytic activity
positive regulation of cell growth
positive regulation of intrinsic apoptotic signaling pathway
positive regulation of melanocyte differentiation
positive regulation of multicellular organism growth
positive regulation of neuron maturation
positive regulation of peptidyl-serine phosphorylation
positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
positive regulation of skeletal muscle fiber development
positive regulation of smooth muscle cell migration
post-embryonic development
programmed cell death
protein dephosphorylation
protein polyubiquitination
reactive oxygen species metabolic process
regulation of calcium ion transport
regulation of cell-matrix adhesion
regulation of gene expression
regulation of glycoprotein biosynthetic process
regulation of mitochondrial membrane permeability
regulation of mitochondrial membrane potential
regulation of nitrogen utilization
regulation of protein heterodimerization activity
regulation of protein homodimerization activity
regulation of protein stability
regulation of transmembrane transporter activity
regulation of viral genome replication
release of cytochrome c from mitochondria
renal system process
response to cytokine
response to drug
response to gamma radiation
response to glucocorticoid
response to hydrogen peroxide
response to iron ion
response to ischemia
response to nicotine
response to radiation
response to toxic substance
response to UV-B
spleen development
T cell differentiation in thymus
T cell homeostasis
thymus development
transmembrane transport - Gene Ontology Molecular Function:
- BH3 domain binding
channel activity
channel inhibitor activity
identical protein binding
protease binding
protein heterodimerization activity
protein homodimerization activity
sequence-specific DNA binding
ubiquitin protein ligase binding - Gene Ontology Cellular Component:
- cytoplasm
cytosol
endoplasmic reticulum
endoplasmic reticulum membrane
membrane
mitochondrial outer membrane
mitochondrion
myelin sheath
nuclear membrane
nucleus
pore complex - Keywords:
- 3D-structure
Alternative splicing
Apoptosis
Chromosomal rearrangement
Complete proteome
Disease mutation
Endoplasmic reticulum
Membrane
Mitochondrion
Mitochondrion outer membrane
Nucleus
Phosphoprotein
Polymorphism
Proto-oncogene
Reference proteome
Transmembrane
Transmembrane helix
Ubl conjugation - Interacts With:
- Itself; Q9C0C7; Q92934; Q61337; Q16611; Q07812; Q9BXH1; P51572; O43521; O43521-1; O43521-2; Q9NYF8; Q14457; P55957; Q13323; Q91ZE9; O60238; P38398; Q5S007; O15151; Q96HR8; Q9C000; P22736; Q13794; O15304; P04637; Q13625