Names & Taxonomy
- Uniprot ID:
- P0CG04
- Entry Name:
- LAC1_HUMAN
- Status:
- reviewed
- Protein Names:
- Ig lambda-1 chain C regions
- Gene Names:
- IGLC1
- Gene Names Primary:
- IGLC1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 106
- Sequence:
- GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Proteomes:
- UP000005640
Function
- Gene Ontology Go:
- blood microparticle
external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
immunoglobulin complex, circulating
plasma membrane
antigen binding
immunoglobulin receptor binding
B cell receptor signaling pathway
complement activation
complement activation, classical pathway
defense response to bacterium
Fc-epsilon receptor signaling pathway
Fc-gamma receptor signaling pathway involved in phagocytosis
immune response
innate immune response
phagocytosis, engulfment
phagocytosis, recognition
positive regulation of B cell activation
receptor-mediated endocytosis
regulation of immune response - Gene Ontology Biological Process:
- B cell receptor signaling pathway
complement activation
complement activation, classical pathway
defense response to bacterium
Fc-epsilon receptor signaling pathway
Fc-gamma receptor signaling pathway involved in phagocytosis
immune response
innate immune response
phagocytosis, engulfment
phagocytosis, recognition
positive regulation of B cell activation
receptor-mediated endocytosis
regulation of immune response - Gene Ontology Molecular Function:
- antigen binding
immunoglobulin receptor binding - Gene Ontology Cellular Component:
- blood microparticle
external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
immunoglobulin complex, circulating
plasma membrane - Keywords:
- 3D-structure
Bence-Jones protein
Complete proteome
Direct protein sequencing
Disulfide bond
Immunoglobulin C region
Immunoglobulin domain
Reference proteome