Names & Taxonomy
- Uniprot ID:
- P09668
- Entry Name:
- CATH_HUMAN
- Status:
- reviewed
- Protein Names:
- Pro-cathepsin H [Cleaved into: Cathepsin H mini chain; Cathepsin H (EC 3.4.22.16); Cathepsin H heavy chain; Cathepsin H light chain]
- Gene Names:
- CTSH CPSB
- Gene Names Primary:
- CTSH
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 335
- Sequence:
- MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Lysosome.
Function
- Function:
- Important for the overall degradation of proteins in lysosomes.
- Catalytic Activity:
- Hydrolysis of proteins, acting as an aminopeptidase (notably, cleaving Arg-|-Xaa bonds) as well as an endopeptidase.
- Active Site:
- ACT_SITE 141 141
- Gene Ontology Go:
- alveolar lamellar body
cytosol
extracellular exosome
extracellular space
lysosome
multivesicular body lumen
aminopeptidase activity
cysteine-type endopeptidase activator activity involved in apoptotic process
cysteine-type endopeptidase activity
cysteine-type peptidase activity
endopeptidase activity
HLA-A specific activating MHC class I receptor activity
peptidase activity
serine-type endopeptidase activity
thyroid hormone binding
activation of cysteine-type endopeptidase activity involved in apoptotic process
adaptive immune response
antigen processing and presentation
bradykinin catabolic process
cellular protein metabolic process
cellular response to thyroid hormone stimulus
dichotomous subdivision of terminal units involved in lung branching
ERK1 and ERK2 cascade
immune response-regulating signaling pathway
membrane protein proteolysis
metanephros development
negative regulation of apoptotic process
neuropeptide catabolic process
positive regulation of angiogenesis
positive regulation of apoptotic signaling pathway
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of epithelial cell migration
positive regulation of gene expression
positive regulation of peptidase activity
protein destabilization
proteolysis
proteolysis involved in cellular protein catabolic process
response to retinoic acid
surfactant homeostasis
T cell mediated cytotoxicity
zymogen activation - Gene Ontology Biological Process:
- activation of cysteine-type endopeptidase activity involved in apoptotic process
adaptive immune response
antigen processing and presentation
bradykinin catabolic process
cellular protein metabolic process
cellular response to thyroid hormone stimulus
dichotomous subdivision of terminal units involved in lung branching
ERK1 and ERK2 cascade
immune response-regulating signaling pathway
membrane protein proteolysis
metanephros development
negative regulation of apoptotic process
neuropeptide catabolic process
positive regulation of angiogenesis
positive regulation of apoptotic signaling pathway
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of epithelial cell migration
positive regulation of gene expression
positive regulation of peptidase activity
protein destabilization
proteolysis
proteolysis involved in cellular protein catabolic process
response to retinoic acid
surfactant homeostasis
T cell mediated cytotoxicity
zymogen activation - Gene Ontology Molecular Function:
- aminopeptidase activity
cysteine-type endopeptidase activator activity involved in apoptotic process
cysteine-type endopeptidase activity
cysteine-type peptidase activity
endopeptidase activity
HLA-A specific activating MHC class I receptor activity
peptidase activity
serine-type endopeptidase activity
thyroid hormone binding - Gene Ontology Cellular Component:
- alveolar lamellar body
cytosol
extracellular exosome
extracellular space
lysosome
multivesicular body lumen - Keywords:
- 3D-structure
Complete proteome
Direct protein sequencing
Disulfide bond
Glycoprotein
Hydrolase
Lysosome
Polymorphism
Protease
Reference proteome
Signal
Thiol protease
Zymogen