Names & Taxonomy
- Uniprot ID:
- P07919
- Entry Name:
- QCR6_HUMAN
- Status:
- reviewed
- Protein Names:
- Cytochrome b-c1 complex subunit 6, mitochondrial (Complex III subunit 6) (Complex III subunit VIII) (Cytochrome c1 non-heme 11 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c reductase complex 11 kDa protein)
- Gene Names:
- UQCRH
- Gene Names Primary:
- UQCRH
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 91
- Sequence:
- MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Mitochondrion inner membrane
Function
- Function:
- This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
- Gene Ontology Go:
- mitochondrial inner membrane
mitochondrial respiratory chain
mitochondrion
ubiquinol-cytochrome-c reductase activity
aerobic respiration
cellular metabolic process
hydrogen ion transmembrane transport
mitochondrial electron transport, ubiquinol to cytochrome c
oxidation-reduction process
oxidative phosphorylation
respiratory electron transport chain
small molecule metabolic process - Gene Ontology Biological Process:
- aerobic respiration
cellular metabolic process
hydrogen ion transmembrane transport
mitochondrial electron transport, ubiquinol to cytochrome c
oxidation-reduction process
oxidative phosphorylation
respiratory electron transport chain
small molecule metabolic process - Gene Ontology Molecular Function:
- ubiquinol-cytochrome-c reductase activity
- Gene Ontology Cellular Component:
- mitochondrial inner membrane
mitochondrial respiratory chain
mitochondrion - Keywords:
- Acetylation
Complete proteome
Disulfide bond
Electron transport
Membrane
Mitochondrion
Mitochondrion inner membrane
Polymorphism
Reference proteome
Respiratory chain
Transit peptide
Transport - Interacts With:
- Q96BM9; Q96H71; Q9Y225