Names & Taxonomy
- Uniprot ID:
- P07766
- Entry Name:
- CD3E_HUMAN
- Status:
- reviewed
- Protein Names:
- T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)
- Gene Names:
- CD3E T3E
- Gene Names Primary:
- CD3E
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 207
- Sequence:
- MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- The CD3 complex mediates signal transduction, resulting in T-cell activation and proliferation. Required for normal immune responses (PubMed:15546002, PubMed:8490660).
- Cross Reference Drug Bank:
- DB00075
- Gene Ontology Go:
- alpha-beta T cell receptor complex
cell-cell junction
external side of plasma membrane
immunological synapse
integral component of plasma membrane
intracellular
plasma membrane
T cell receptor complex
protein heterodimerization activity
protein kinase binding
receptor signaling complex scaffold activity
receptor signaling protein activity
SH3 domain binding
T cell receptor binding
transmembrane signaling receptor activity
apoptotic signaling pathway
cell surface receptor signaling pathway
G-protein coupled receptor signaling pathway
negative regulation of gene expression
negative regulation of smoothened signaling pathway
negative thymic T cell selection
positive regulation of alpha-beta T cell proliferation
positive regulation of calcium-mediated signaling
positive regulation of gene expression
positive regulation of interferon-gamma production
positive regulation of interleukin-2 biosynthetic process
positive regulation of interleukin-4 production
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of T cell anergy
positive regulation of T cell proliferation
protein complex assembly
regulation of apoptotic process
regulation of immune response
response to nutrient
signal complex assembly
T cell activation
T cell costimulation
T cell receptor signaling pathway
transmembrane receptor protein tyrosine kinase signaling pathway - Gene Ontology Biological Process:
- apoptotic signaling pathway
cell surface receptor signaling pathway
G-protein coupled receptor signaling pathway
negative regulation of gene expression
negative regulation of smoothened signaling pathway
negative thymic T cell selection
positive regulation of alpha-beta T cell proliferation
positive regulation of calcium-mediated signaling
positive regulation of gene expression
positive regulation of interferon-gamma production
positive regulation of interleukin-2 biosynthetic process
positive regulation of interleukin-4 production
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of T cell anergy
positive regulation of T cell proliferation
protein complex assembly
regulation of apoptotic process
regulation of immune response
response to nutrient
signal complex assembly
T cell activation
T cell costimulation
T cell receptor signaling pathway
transmembrane receptor protein tyrosine kinase signaling pathway - Gene Ontology Molecular Function:
- protein heterodimerization activity
protein kinase binding
receptor signaling complex scaffold activity
receptor signaling protein activity
SH3 domain binding
T cell receptor binding
transmembrane signaling receptor activity - Gene Ontology Cellular Component:
- alpha-beta T cell receptor complex
cell-cell junction
external side of plasma membrane
immunological synapse
integral component of plasma membrane
intracellular
plasma membrane
T cell receptor complex - Keywords:
- 3D-structure
Cell membrane
Complete proteome
Disulfide bond
Immunity
Immunoglobulin domain
Membrane
Phosphoprotein
Receptor
Reference proteome
Signal
Transmembrane
Transmembrane helix - Interacts With:
- Q8TE68; P16333; P43405; P43403