Names & Taxonomy
- Uniprot ID:
- P07203
- Entry Name:
- GPX1_HUMAN
- Status:
- reviewed
- Protein Names:
- Glutathione peroxidase 1 (GPx-1) (GSHPx-1) (EC 1.11.1.9) (Cellular glutathione peroxidase)
- Gene Names:
- GPX1
- Gene Names Primary:
- GPX1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 203
- Sequence:
- MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm.
Function
- Function:
- Protects the hemoglobin in erythrocytes from oxidative breakdown.
- Catalytic Activity:
- 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
- Active Site:
- ACT_SITE 49 49
- Cross Reference Drug Bank:
- DB00143
- Gene Ontology Go:
- cytoplasm
cytosol
extracellular exosome
mitochondrial matrix
mitochondrion
glutathione peroxidase activity
SH3 domain binding
angiogenesis involved in wound healing
arachidonic acid metabolic process
blood vessel endothelial cell migration
cell redox homeostasis
cellular oxidant detoxification
cellular response to oxidative stress
endothelial cell development
fat cell differentiation
glutathione metabolic process
heart contraction
hydrogen peroxide catabolic process
interaction with symbiont
intrinsic apoptotic signaling pathway in response to oxidative stress
lipoxygenase pathway
myoblast proliferation
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
negative regulation of inflammatory response to antigenic stimulus
negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
negative regulation of release of cytochrome c from mitochondria
nucleobase-containing small molecule metabolic process
positive regulation of fibril organization
positive regulation of protein kinase B signaling
protein oxidation
purine nucleobase metabolic process
purine nucleotide catabolic process
regulation of gene expression, epigenetic
regulation of mammary gland epithelial cell proliferation
regulation of neuron apoptotic process
regulation of proteasomal protein catabolic process
response to gamma radiation
response to hydrogen peroxide
response to hydroperoxide
response to reactive oxygen species
response to selenium ion
response to symbiotic bacterium
response to xenobiotic stimulus
sensory perception of sound
skeletal muscle fiber development
skeletal muscle tissue regeneration
small molecule metabolic process
temperature homeostasis
triglyceride metabolic process
UV protection
vasodilation - Gene Ontology Biological Process:
- angiogenesis involved in wound healing
arachidonic acid metabolic process
blood vessel endothelial cell migration
cell redox homeostasis
cellular oxidant detoxification
cellular response to oxidative stress
endothelial cell development
fat cell differentiation
glutathione metabolic process
heart contraction
hydrogen peroxide catabolic process
interaction with symbiont
intrinsic apoptotic signaling pathway in response to oxidative stress
lipoxygenase pathway
myoblast proliferation
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
negative regulation of inflammatory response to antigenic stimulus
negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
negative regulation of release of cytochrome c from mitochondria
nucleobase-containing small molecule metabolic process
positive regulation of fibril organization
positive regulation of protein kinase B signaling
protein oxidation
purine nucleobase metabolic process
purine nucleotide catabolic process
regulation of gene expression, epigenetic
regulation of mammary gland epithelial cell proliferation
regulation of neuron apoptotic process
regulation of proteasomal protein catabolic process
response to gamma radiation
response to hydrogen peroxide
response to hydroperoxide
response to reactive oxygen species
response to selenium ion
response to symbiotic bacterium
response to xenobiotic stimulus
sensory perception of sound
skeletal muscle fiber development
skeletal muscle tissue regeneration
small molecule metabolic process
temperature homeostasis
triglyceride metabolic process
UV protection
vasodilation - Gene Ontology Molecular Function:
- glutathione peroxidase activity
SH3 domain binding - Gene Ontology Cellular Component:
- cytoplasm
cytosol
extracellular exosome
mitochondrial matrix
mitochondrion - Keywords:
- 3D-structure
Acetylation
Alternative splicing
Complete proteome
Cytoplasm
Oxidoreductase
Peroxidase
Phosphoprotein
Polymorphism
Reference proteome
Selenocysteine