Names & Taxonomy
- Uniprot ID:
- P05231
- Entry Name:
- IL6_HUMAN
- Status:
- reviewed
- Protein Names:
- Interleukin-6 (IL-6) (B-cell stimulatory factor 2) (BSF-2) (CTL differentiation factor) (CDF) (Hybridoma growth factor) (Interferon beta-2) (IFN-beta-2)
- Gene Names:
- IL6 IFNB2
- Gene Names Primary:
- IL6
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 212
- Sequence:
- MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.
- Cross Reference Drug Bank:
- DB01404 DB09036
- Gene Ontology Go:
- cytoplasm
external side of plasma membrane
extracellular region
extracellular space
interleukin-6 receptor complex
cytokine activity
growth factor activity
interleukin-6 receptor binding
acute-phase response
aging
bone remodeling
branching involved in salivary gland morphogenesis
cell growth
cell redox homeostasis
cellular response to dexamethasone stimulus
cellular response to hepatocyte growth factor stimulus
cellular response to hydrogen peroxide
cellular response to interleukin-1
cellular response to lipopolysaccharide
cellular response to tumor necrosis factor
cytokine-mediated signaling pathway
defense response to Gram-negative bacterium
defense response to Gram-positive bacterium
defense response to protozoan
defense response to virus
endocrine pancreas development
epithelial cell proliferation involved in salivary gland morphogenesis
glucagon secretion
glucose homeostasis
hepatic immune response
humoral immune response
inflammatory response
interleukin-6-mediated signaling pathway
monocyte chemotaxis
muscle cell cellular homeostasis
negative regulation of apoptotic process
negative regulation of cell proliferation
negative regulation of chemokine biosynthetic process
negative regulation of collagen biosynthetic process
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
negative regulation of cytokine secretion
negative regulation of fat cell differentiation
negative regulation of gluconeogenesis
negative regulation of hormone secretion
negative regulation of lipid storage
negative regulation of muscle organ development
negative regulation of neuron death
negative regulation of protein kinase activity
neuron projection development
neutrophil apoptotic process
neutrophil mediated immunity
platelet activation
positive regulation of acute inflammatory response
positive regulation of apoptotic process
positive regulation of B cell activation
positive regulation of cell proliferation
positive regulation of cell proliferation in bone marrow
positive regulation of chemokine production
positive regulation of DNA replication
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of gene expression
positive regulation of immunoglobulin secretion
positive regulation of interleukin-6 production
positive regulation of JAK-STAT cascade
positive regulation of leukocyte chemotaxis
positive regulation of MAPK cascade
positive regulation of neuron differentiation
positive regulation of nitric oxide biosynthetic process
positive regulation of osteoblast differentiation
positive regulation of peptidyl-serine phosphorylation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of protein import into nucleus, translocation
positive regulation of protein kinase B signaling
positive regulation of sequence-specific DNA binding transcription factor activity
positive regulation of smooth muscle cell proliferation
positive regulation of STAT protein import into nucleus
positive regulation of T cell proliferation
positive regulation of T-helper 2 cell differentiation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription, DNA-templated
positive regulation of translation
positive regulation of transmission of nerve impulse
positive regulation of type B pancreatic cell apoptotic process
positive regulation of tyrosine phosphorylation of Stat3 protein
regulation of angiogenesis
regulation of cell shape
regulation of circadian sleep/wake cycle, non-REM sleep
regulation of vascular endothelial growth factor production
response to amino acid
response to antibiotic
response to auditory stimulus
response to caffeine
response to calcium ion
response to cold
response to drug
response to electrical stimulus
response to glucocorticoid
response to heat
response to insulin
response to nutrient levels
response to peptidoglycan
response to yeast
T-helper 17 cell lineage commitment - Gene Ontology Biological Process:
- acute-phase response
aging
bone remodeling
branching involved in salivary gland morphogenesis
cell growth
cell redox homeostasis
cellular response to dexamethasone stimulus
cellular response to hepatocyte growth factor stimulus
cellular response to hydrogen peroxide
cellular response to interleukin-1
cellular response to lipopolysaccharide
cellular response to tumor necrosis factor
cytokine-mediated signaling pathway
defense response to Gram-negative bacterium
defense response to Gram-positive bacterium
defense response to protozoan
defense response to virus
endocrine pancreas development
epithelial cell proliferation involved in salivary gland morphogenesis
glucagon secretion
glucose homeostasis
hepatic immune response
humoral immune response
inflammatory response
interleukin-6-mediated signaling pathway
monocyte chemotaxis
muscle cell cellular homeostasis
negative regulation of apoptotic process
negative regulation of cell proliferation
negative regulation of chemokine biosynthetic process
negative regulation of collagen biosynthetic process
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
negative regulation of cytokine secretion
negative regulation of fat cell differentiation
negative regulation of gluconeogenesis
negative regulation of hormone secretion
negative regulation of lipid storage
negative regulation of muscle organ development
negative regulation of neuron death
negative regulation of protein kinase activity
neuron projection development
neutrophil apoptotic process
neutrophil mediated immunity
platelet activation
positive regulation of acute inflammatory response
positive regulation of apoptotic process
positive regulation of B cell activation
positive regulation of cell proliferation
positive regulation of cell proliferation in bone marrow
positive regulation of chemokine production
positive regulation of DNA replication
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of gene expression
positive regulation of immunoglobulin secretion
positive regulation of interleukin-6 production
positive regulation of JAK-STAT cascade
positive regulation of leukocyte chemotaxis
positive regulation of MAPK cascade
positive regulation of neuron differentiation
positive regulation of nitric oxide biosynthetic process
positive regulation of osteoblast differentiation
positive regulation of peptidyl-serine phosphorylation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of protein import into nucleus, translocation
positive regulation of protein kinase B signaling
positive regulation of sequence-specific DNA binding transcription factor activity
positive regulation of smooth muscle cell proliferation
positive regulation of STAT protein import into nucleus
positive regulation of T cell proliferation
positive regulation of T-helper 2 cell differentiation
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
positive regulation of translation
positive regulation of transmission of nerve impulse
positive regulation of type B pancreatic cell apoptotic process
positive regulation of tyrosine phosphorylation of Stat3 protein
regulation of angiogenesis
regulation of cell shape
regulation of circadian sleep/wake cycle, non-REM sleep
regulation of vascular endothelial growth factor production
response to amino acid
response to antibiotic
response to auditory stimulus
response to caffeine
response to calcium ion
response to cold
response to drug
response to electrical stimulus
response to glucocorticoid
response to heat
response to insulin
response to nutrient levels
response to peptidoglycan
response to yeast
T-helper 17 cell lineage commitment - Gene Ontology Molecular Function:
- cytokine activity
growth factor activity
interleukin-6 receptor binding - Gene Ontology Cellular Component:
- cytoplasm
external side of plasma membrane
extracellular region
extracellular space
interleukin-6 receptor complex - Keywords:
- 3D-structure
Acute phase
Complete proteome
Cytokine
Direct protein sequencing
Disulfide bond
Glycoprotein
Growth factor
Phosphoprotein
Polymorphism
Reference proteome
Secreted
Signal - Interacts With:
- P08887; Q05516