Names & Taxonomy
- Uniprot ID:
- P05181
- Entry Name:
- CP2E1_HUMAN
- Status:
- reviewed
- Protein Names:
- Cytochrome P450 2E1 (EC 1.14.13.-) (4-nitrophenol 2-hydroxylase) (EC 1.14.13.n7) (CYPIIE1) (Cytochrome P450-J) [Cleaved into: Cytochrome P450 2E1, N-terminally processed]
- Gene Names:
- CYP2E1 CYP2E
- Gene Names Primary:
- CYP2E1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 493
- Sequence:
- MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Function
- Function:
- Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites. Inactivates a number of drugs and xenobiotics and also bioactivates many xenobiotic substrates to their hepatotoxic or carcinogenic forms.
- Catalytic Activity:
- 4-nitrophenol + NADPH + O(2) = 4-nitrocatechol + NADP(+) + H(2)O.
- Cofactor:
- COFACTOR: Name=heme; Xref=ChEBI:CHEBI:30413;
- Cross Reference Drug Bank:
- DB00316 DB00041 DB00918 DB00969 DB01223 DB00321 DB01435 DB00972 DB06770 DB04794 DB01558 DB00835 DB01156 DB00201 DB06774 DB00748 DB01136 DB00477 DB00356 DB00501 DB00215 DB04920 DB00636 DB00882 DB01068 DB00257 DB00363 DB01394 DB00851 DB06637 DB00250 DB01151 DB01234 DB01191 DB00633 DB00514 DB00829 DB00586 DB00255 DB00822 DB01127 DB00228 DB00109 DB00655 DB00898 DB06689 DB00593 DB00773 DB01628 DB00949 DB08868 DB01544 DB00623 DB00690 DB00176 DB00158 DB01213 DB01296 DB01159 DB01355 DB04946 DB00458 DB00753 DB00951 DB00883 DB01167 DB00170 DB00371 DB00703 DB00763 DB01403 DB01028 DB01011 DB00379 DB01110 DB00683 DB01204 DB00622 DB02701 DB00184 DB01115 DB06712 DB01595 DB00540 DB00904 DB01173 DB00526 DB00617 DB00780 DB01174 DB01085 DB01100 DB01131 DB00818 DB00908 DB00468 DB01045 DB00503 DB06201 DB00118 DB01037 DB01236 DB00203 DB00428 DB00359 DB00259 DB00675 DB01041 DB01412 DB00277 DB00599 DB00679 DB00208 DB01007 DB05109 DB00752 DB00347 DB01586 DB00549 DB01198
- Gene Ontology Go:
- endoplasmic reticulum membrane
Golgi membrane
intrinsic component of endoplasmic reticulum membrane
mitochondrion
arachidonic acid epoxygenase activity
enzyme binding
heme binding
iron ion binding
monooxygenase activity
oxidoreductase activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
oxygen binding
steroid hydroxylase activity
drug metabolic process
epoxygenase P450 pathway
heterocycle metabolic process
monoterpenoid metabolic process
oxidation-reduction process
response to drug
response to ethanol
response to organonitrogen compound
response to ozone
small molecule metabolic process
steroid metabolic process
triglyceride metabolic process
xenobiotic metabolic process - Gene Ontology Biological Process:
- drug metabolic process
epoxygenase P450 pathway
heterocycle metabolic process
monoterpenoid metabolic process
oxidation-reduction process
response to drug
response to ethanol
response to organonitrogen compound
response to ozone
small molecule metabolic process
steroid metabolic process
triglyceride metabolic process
xenobiotic metabolic process - Gene Ontology Molecular Function:
- arachidonic acid epoxygenase activity
enzyme binding
heme binding
iron ion binding
monooxygenase activity
oxidoreductase activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
oxygen binding
steroid hydroxylase activity - Gene Ontology Cellular Component:
- endoplasmic reticulum membrane
Golgi membrane
intrinsic component of endoplasmic reticulum membrane
mitochondrion - Keywords:
- 3D-structure
Complete proteome
Direct protein sequencing
Endoplasmic reticulum
Heme
Iron
Membrane
Metal-binding
Microsome
Monooxygenase
NADP
Oxidoreductase
Polymorphism
Reference proteome