Names & Taxonomy
- Uniprot ID:
- P04004
- Entry Name:
- VTNC_HUMAN
- Status:
- reviewed
- Protein Names:
- Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) [Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B]
- Gene Names:
- VTN
- Gene Names Primary:
- VTN
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 478
- Sequence:
- MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted, extracellular space.
Function
- Function:
- Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.; Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity.
- Cross Reference Drug Bank:
- DB00054
- Gene Ontology Go:
- alphav-beta3 integrin-vitronectin complex
blood microparticle
extracellular exosome
extracellular matrix
extracellular region
extracellular space
proteinaceous extracellular matrix
extracellular matrix binding
heparin binding
integrin binding
polysaccharide binding
scavenger receptor activity
cell adhesion
cell adhesion mediated by integrin
cell-matrix adhesion
endodermal cell differentiation
extracellular matrix organization
immune response
innate immune response
negative regulation of blood coagulation
negative regulation of endopeptidase activity
oligodendrocyte differentiation
positive regulation of cell-substrate adhesion
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of protein binding
positive regulation of receptor-mediated endocytosis
positive regulation of smooth muscle cell migration
positive regulation of vascular endothelial growth factor receptor signaling pathway
positive regulation of wound healing
regulation of complement activation
smooth muscle cell-matrix adhesion - Gene Ontology Biological Process:
- cell adhesion
cell adhesion mediated by integrin
cell-matrix adhesion
endodermal cell differentiation
extracellular matrix organization
immune response
innate immune response
negative regulation of blood coagulation
negative regulation of endopeptidase activity
oligodendrocyte differentiation
positive regulation of cell-substrate adhesion
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of protein binding
positive regulation of receptor-mediated endocytosis
positive regulation of smooth muscle cell migration
positive regulation of vascular endothelial growth factor receptor signaling pathway
positive regulation of wound healing
regulation of complement activation
smooth muscle cell-matrix adhesion - Gene Ontology Molecular Function:
- extracellular matrix binding
heparin binding
integrin binding
polysaccharide binding
scavenger receptor activity - Gene Ontology Cellular Component:
- alphav-beta3 integrin-vitronectin complex
blood microparticle
extracellular exosome
extracellular matrix
extracellular region
extracellular space
proteinaceous extracellular matrix - Keywords:
- 3D-structure
Cell adhesion
Complete proteome
Direct protein sequencing
Disulfide bond
Glycoprotein
Heparin-binding
Phosphoprotein
Polymorphism
Reference proteome
Repeat
Secreted
Signal
Sulfation - Interacts With:
- Q07021; Q9HD26