Names & Taxonomy
- Uniprot ID:
- P03950
- Entry Name:
- ANGI_HUMAN
- Status:
- reviewed
- Protein Names:
- Angiogenin (EC 3.1.27.-) (Ribonuclease 5) (RNase 5)
- Gene Names:
- ANG RNASE5
- Gene Names Primary:
- ANG
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 147
- Sequence:
- MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasmic vesicle, secretory vesicle lumen
Function
- Function:
- Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.
- Active Site:
- ACT_SITE 37 37 Proton acceptor.; ACT_SITE 138 138 Proton donor.
- Gene Ontology Go:
- angiogenin-PRI complex
basal lamina
cytoplasmic, membrane-bounded vesicle
extracellular exosome
extracellular region
extracellular space
growth cone
neuronal cell body
nucleolus
nucleus
actin binding
copper ion binding
DNA binding
endonuclease activity
heparin binding
peptide binding
protein homodimerization activity
receptor binding
ribonuclease activity
rRNA binding
actin filament polymerization
activation of phospholipase A2 activity
activation of phospholipase C activity
activation of protein kinase B activity
adherens junction organization
angiogenesis
antibacterial humoral response
antifungal humoral response
cell communication
cell junction assembly
cell migration
cell-cell junction organization
defense response to Gram-positive bacterium
diacylglycerol biosynthetic process
homeostatic process
innate immune response
negative regulation of smooth muscle cell proliferation
negative regulation of translation
nucleic acid phosphodiester bond hydrolysis
oocyte maturation
ovarian follicle development
placenta development
positive regulation of endothelial cell proliferation
positive regulation of phosphorylation
positive regulation of protein secretion
response to hormone
response to hypoxia
response to yeast
RNA phosphodiester bond hydrolysis
rRNA transcription - Gene Ontology Biological Process:
- actin filament polymerization
activation of phospholipase A2 activity
activation of phospholipase C activity
activation of protein kinase B activity
adherens junction organization
angiogenesis
antibacterial humoral response
antifungal humoral response
cell-cell junction organization
cell communication
cell junction assembly
cell migration
defense response to Gram-positive bacterium
diacylglycerol biosynthetic process
homeostatic process
innate immune response
negative regulation of smooth muscle cell proliferation
negative regulation of translation
nucleic acid phosphodiester bond hydrolysis
oocyte maturation
ovarian follicle development
placenta development
positive regulation of endothelial cell proliferation
positive regulation of phosphorylation
positive regulation of protein secretion
response to hormone
response to hypoxia
response to yeast
RNA phosphodiester bond hydrolysis
rRNA transcription - Gene Ontology Molecular Function:
- actin binding
copper ion binding
DNA binding
endonuclease activity
heparin binding
peptide binding
protein homodimerization activity
receptor binding
ribonuclease activity
rRNA binding - Gene Ontology Cellular Component:
- angiogenin-PRI complex
basal lamina
cytoplasmic, membrane-bounded vesicle
extracellular exosome
extracellular region
extracellular space
growth cone
neuronal cell body
nucleolus
nucleus - Keywords:
- 3D-structure
Amyotrophic lateral sclerosis
Angiogenesis
Complete proteome
Cytoplasmic vesicle
DNA-binding
Developmental protein
Differentiation
Direct protein sequencing
Disease mutation
Disulfide bond
Endonuclease
Hydrolase
Neurodegeneration
Nuclease
Nucleus
Polymorphism
Protein synthesis inhibitor
Pyrrolidone carboxylic acid
Reference proteome
Secreted
Signal
Stress response - Interacts With:
- P35609; P19883; P13489