Names & Taxonomy
- Uniprot ID:
- P02818
- Entry Name:
- OSTCN_HUMAN
- Status:
- reviewed
- Protein Names:
- Osteocalcin (Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein)
- Gene Names:
- BGLAP
- Gene Names Primary:
- BGLAP
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 100
- Sequence:
- MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
- Cross Reference Drug Bank:
- DB05260 DB00170 DB01022
- Gene Ontology Go:
- cytoplasm
dendrite
endoplasmic reticulum lumen
extracellular space
Golgi lumen
membrane-bounded vesicle
perikaryon
rough endoplasmic reticulum
calcium ion binding
hydroxyapatite binding
structural constituent of bone
structural molecule activity
bone development
bone mineralization
cell adhesion
cell aging
cellular protein metabolic process
cellular response to growth factor stimulus
cellular response to vitamin D
ER to Golgi vesicle-mediated transport
odontogenesis
osteoblast development
osteoblast differentiation
peptidyl-glutamic acid carboxylation
post-translational protein modification
regulation of bone mineralization
regulation of bone resorption
regulation of osteoclast differentiation
response to activity
response to drug
response to estrogen
response to ethanol
response to glucocorticoid
response to gravity
response to hydroxyisoflavone
response to mechanical stimulus
response to testosterone
response to vitamin D
response to vitamin K
response to zinc ion
signal peptide processing
skeletal system development - Gene Ontology Biological Process:
- bone development
bone mineralization
cell adhesion
cell aging
cellular protein metabolic process
cellular response to growth factor stimulus
cellular response to vitamin D
ER to Golgi vesicle-mediated transport
odontogenesis
osteoblast development
osteoblast differentiation
peptidyl-glutamic acid carboxylation
post-translational protein modification
regulation of bone mineralization
regulation of bone resorption
regulation of osteoclast differentiation
response to activity
response to drug
response to estrogen
response to ethanol
response to glucocorticoid
response to gravity
response to hydroxyisoflavone
response to mechanical stimulus
response to testosterone
response to vitamin D
response to vitamin K
response to zinc ion
signal peptide processing
skeletal system development - Gene Ontology Molecular Function:
- calcium ion binding
hydroxyapatite binding
structural constituent of bone
structural molecule activity - Gene Ontology Cellular Component:
- cytoplasm
dendrite
endoplasmic reticulum lumen
extracellular space
Golgi lumen
membrane-bounded vesicle
perikaryon
rough endoplasmic reticulum - Keywords:
- Biomineralization
Calcium
Cleavage on pair of basic residues
Complete proteome
Direct protein sequencing
Disulfide bond
Gamma-carboxyglutamic acid
Metal-binding
Polymorphism
Reference proteome
Secreted
Signal