Names & Taxonomy
- Uniprot ID:
- P02763
- Entry Name:
- A1AG1_HUMAN
- Status:
- reviewed
- Protein Names:
- Alpha-1-acid glycoprotein 1 (AGP 1) (Orosomucoid-1) (OMD 1)
- Gene Names:
- ORM1 AGP1
- Gene Names Primary:
- ORM1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 201
- Sequence:
- MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
- Cross Reference Drug Bank:
- DB05812 DB01418 DB01426 DB00802 DB00321 DB00543 DB01429 DB01156 DB08907 DB00482 DB00477 DB01151 DB00280 DB00590 DB01142 DB00530 DB00472 DB00317 DB00619 DB00458 DB08820 DB00934 DB08893 DB00731 DB00540 DB00334 DB00497 DB01359 DB00454 DB00946 DB08860 DB00457 DB00571 DB00908 DB08931 DB01232 DB00864 DB00706 DB05521 DB01041 DB00656 DB08867 DB05294 DB08881 DB08828 DB00682
- Gene Ontology Go:
- blood microparticle
extracellular exosome
extracellular region
extracellular space
acute-phase response
inflammatory response
negative regulation of interleukin-6 production
negative regulation of tumor necrosis factor production
regulation of immune system process
transport - Gene Ontology Biological Process:
- acute-phase response
inflammatory response
negative regulation of interleukin-6 production
negative regulation of tumor necrosis factor production
regulation of immune system process
transport - Gene Ontology Cellular Component:
- blood microparticle
extracellular exosome
extracellular region
extracellular space - Keywords:
- 3D-structure
Acute phase
Complete proteome
Direct protein sequencing
Disulfide bond
Glycoprotein
Polymorphism
Pyrrolidone carboxylic acid
Reference proteome
Secreted
Signal
Transport - Interacts With:
- P05121