Names & Taxonomy
- Uniprot ID:
- P01877
- Entry Name:
- IGHA2_HUMAN
- Status:
- reviewed
- Protein Names:
- Ig alpha-2 chain C region
- Gene Names:
- IGHA2
- Gene Names Primary:
- IGHA2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 340
- Sequence:
- ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRMAGKPTHVNVSVVMAEVDGTCY
- Proteomes:
- UP000005640
Function
- Function:
- Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system.
- Gene Ontology Go:
- blood microparticle
external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
monomeric IgA immunoglobulin complex
secretory dimeric IgA immunoglobulin complex
secretory IgA immunoglobulin complex
antigen binding
antibacterial humoral response
B cell receptor signaling pathway
complement activation, classical pathway
glomerular filtration
immune response
innate immune response
phagocytosis, engulfment
phagocytosis, recognition
positive regulation of B cell activation
positive regulation of respiratory burst
receptor-mediated endocytosis
retina homeostasis - Gene Ontology Biological Process:
- antibacterial humoral response
B cell receptor signaling pathway
complement activation, classical pathway
glomerular filtration
immune response
innate immune response
phagocytosis, engulfment
phagocytosis, recognition
positive regulation of B cell activation
positive regulation of respiratory burst
receptor-mediated endocytosis
retina homeostasis - Gene Ontology Molecular Function:
- antigen binding
- Gene Ontology Cellular Component:
- blood microparticle
external side of plasma membrane
extracellular exosome
extracellular region
extracellular space
monomeric IgA immunoglobulin complex
secretory dimeric IgA immunoglobulin complex
secretory IgA immunoglobulin complex - Keywords:
- 3D-structure
Complete proteome
Direct protein sequencing
Disulfide bond
Glycoprotein
Immunoglobulin C region
Immunoglobulin domain
Reference proteome
Repeat