Names & Taxonomy
- Uniprot ID:
- P01374
- Entry Name:
- TNFB_HUMAN
- Status:
- reviewed
- Protein Names:
- Lymphotoxin-alpha (LT-alpha) (TNF-beta) (Tumor necrosis factor ligand superfamily member 1)
- Gene Names:
- LTA TNFB TNFSF1
- Gene Names Primary:
- LTA
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 205
- Sequence:
- MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted. Membrane. Note=The homotrimer is secreted. The heterotrimer is membrane-associated.
Function
- Function:
- Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
- Cross Reference Drug Bank:
- DB00005
- Gene Ontology Go:
- extracellular space
plasma membrane
receptor binding
apoptotic process
cell-cell signaling
defense response to Gram-positive bacterium
humoral immune response
lymph node development
negative regulation of fibroblast proliferation
negative regulation of growth of symbiont in host
positive regulation of apoptotic process
positive regulation of chronic inflammatory response to antigenic stimulus
positive regulation of glial cell proliferation
positive regulation of humoral immune response mediated by circulating immunoglobulin
positive regulation of interferon-gamma production
response to drug
response to hypoxia
response to lipopolysaccharide
response to nutrient
signal transduction
tumor necrosis factor-mediated signaling pathway - Gene Ontology Biological Process:
- apoptotic process
cell-cell signaling
defense response to Gram-positive bacterium
humoral immune response
lymph node development
negative regulation of fibroblast proliferation
negative regulation of growth of symbiont in host
positive regulation of apoptotic process
positive regulation of chronic inflammatory response to antigenic stimulus
positive regulation of glial cell proliferation
positive regulation of humoral immune response mediated by circulating immunoglobulin
positive regulation of interferon-gamma production
response to drug
response to hypoxia
response to lipopolysaccharide
response to nutrient
signal transduction
tumor necrosis factor-mediated signaling pathway - Gene Ontology Molecular Function:
- receptor binding
- Gene Ontology Cellular Component:
- extracellular space
plasma membrane - Keywords:
- 3D-structure
Complete proteome
Cytokine
Direct protein sequencing
Glycoprotein
Membrane
Polymorphism
Reference proteome
Secreted
Signal