Names & Taxonomy
- Uniprot ID:
- P01138
- Entry Name:
- NGF_HUMAN
- Status:
- reviewed
- Protein Names:
- Beta-nerve growth factor (Beta-NGF)
- Gene Names:
- NGF NGFB
- Gene Names Primary:
- NGF
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 241
- Sequence:
- MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177).
- Cross Reference Drug Bank:
- DB01407
- Gene Ontology Go:
- cytoplasmic, membrane-bounded vesicle
endosome
extracellular region
Golgi lumen
growth factor activity
metalloendopeptidase inhibitor activity
nerve growth factor receptor binding
activation of MAPKK activity
activation of phospholipase C activity
apoptotic signaling pathway
cell-cell signaling
extrinsic apoptotic signaling pathway via death domain receptors
negative regulation of apoptotic process
negative regulation of cell cycle
negative regulation of endopeptidase activity
negative regulation of neuron apoptotic process
nerve growth factor processing
neuron projection morphogenesis
neurotrophin TRK receptor signaling pathway
phosphatidylinositol-mediated signaling
positive regulation of apoptotic process
positive regulation of axonogenesis
positive regulation of gene expression
Ras protein signal transduction
regulation of axonogenesis
regulation of cysteine-type endopeptidase activity involved in apoptotic process
regulation of neuron differentiation
small GTPase mediated signal transduction
transmembrane receptor protein tyrosine kinase signaling pathway - Gene Ontology Biological Process:
- activation of MAPKK activity
activation of phospholipase C activity
apoptotic signaling pathway
cell-cell signaling
extrinsic apoptotic signaling pathway via death domain receptors
negative regulation of apoptotic process
negative regulation of cell cycle
negative regulation of endopeptidase activity
negative regulation of neuron apoptotic process
nerve growth factor processing
neuron projection morphogenesis
neurotrophin TRK receptor signaling pathway
phosphatidylinositol-mediated signaling
positive regulation of apoptotic process
positive regulation of axonogenesis
positive regulation of gene expression
Ras protein signal transduction
regulation of axonogenesis
regulation of cysteine-type endopeptidase activity involved in apoptotic process
regulation of neuron differentiation
small GTPase mediated signal transduction
transmembrane receptor protein tyrosine kinase signaling pathway - Gene Ontology Molecular Function:
- growth factor activity
metalloendopeptidase inhibitor activity
nerve growth factor receptor binding - Gene Ontology Cellular Component:
- cytoplasmic, membrane-bounded vesicle
endosome
extracellular region
Golgi lumen - Keywords:
- 3D-structure
Cleavage on pair of basic residues
Complete proteome
Disease mutation
Disulfide bond
Glycoprotein
Growth factor
Metalloenzyme inhibitor
Metalloprotease inhibitor
Neurodegeneration
Neuropathy
Polymorphism
Protease inhibitor
Reference proteome
Secreted
Signal - Interacts With:
- P08138; P07174; P04629; Q99523