Names & Taxonomy
- Uniprot ID:
- P01112
- Entry Name:
- RASH_HUMAN
- Status:
- reviewed
- Protein Names:
- GTPase HRas (H-Ras-1) (Ha-Ras) (Transforming protein p21) (c-H-ras) (p21ras) [Cleaved into: GTPase HRas, N-terminally processed]
- Gene Names:
- HRAS HRAS1
- Gene Names Primary:
- HRAS
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 189
- Sequence:
- MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane. Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Golgi apparatus membrane; Lipid-anchor. Note=The active GTP-bound form is localized most strongly to membranes than the inactive GDP-bound form (By similarity). Shuttles between the plasma membrane and the Golgi apparatus.
Function
- Function:
- Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
- Enzyme Regulation:
- ENZYME REGULATION: Alternates between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP).
- Gene Ontology Go:
- cytoplasm
cytosol
Golgi apparatus
Golgi membrane
nucleus
perinuclear region of cytoplasm
plasma membrane
GTP binding
GTPase activity
protein C-terminus binding
activation of MAPKK activity
axon guidance
blood coagulation
cell cycle arrest
cell proliferation
cell surface receptor signaling pathway
cellular senescence
chemotaxis
defense response to protozoan
endocytosis
ephrin receptor signaling pathway
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
innate immune response
insulin receptor signaling pathway
intrinsic apoptotic signaling pathway
leukocyte migration
MAPK cascade
mitotic cell cycle checkpoint
negative regulation of cell proliferation
negative regulation of gene expression
negative regulation of GTPase activity
negative regulation of neuron apoptotic process
neurotrophin TRK receptor signaling pathway
organ morphogenesis
positive regulation of actin cytoskeleton reorganization
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of DNA replication
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of GTPase activity
positive regulation of interferon-gamma production
positive regulation of JNK cascade
positive regulation of MAP kinase activity
positive regulation of MAPK cascade
positive regulation of miRNA metabolic process
positive regulation of protein phosphorylation
positive regulation of Ras protein signal transduction
positive regulation of ruffle assembly
positive regulation of transcription from RNA polymerase II promoter
positive regulation of wound healing
protein heterooligomerization
Ras protein signal transduction
regulation of long-term neuronal synaptic plasticity
signal transduction
small GTPase mediated signal transduction
social behavior
stimulatory C-type lectin receptor signaling pathway
synaptic transmission
T cell receptor signaling pathway
T-helper 1 type immune response
vascular endothelial growth factor receptor signaling pathway - Gene Ontology Biological Process:
- activation of MAPKK activity
axon guidance
blood coagulation
cell cycle arrest
cell proliferation
cell surface receptor signaling pathway
cellular senescence
chemotaxis
defense response to protozoan
endocytosis
ephrin receptor signaling pathway
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
innate immune response
insulin receptor signaling pathway
intrinsic apoptotic signaling pathway
leukocyte migration
MAPK cascade
mitotic cell cycle checkpoint
negative regulation of cell proliferation
negative regulation of gene expression
negative regulation of GTPase activity
negative regulation of neuron apoptotic process
neurotrophin TRK receptor signaling pathway
organ morphogenesis
positive regulation of actin cytoskeleton reorganization
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of DNA replication
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of GTPase activity
positive regulation of interferon-gamma production
positive regulation of JNK cascade
positive regulation of MAPK cascade
positive regulation of MAP kinase activity
positive regulation of miRNA metabolic process
positive regulation of protein phosphorylation
positive regulation of Ras protein signal transduction
positive regulation of ruffle assembly
positive regulation of transcription from RNA polymerase II promoter
positive regulation of wound healing
protein heterooligomerization
Ras protein signal transduction
regulation of long-term neuronal synaptic plasticity
signal transduction
small GTPase mediated signal transduction
social behavior
stimulatory C-type lectin receptor signaling pathway
synaptic transmission
T cell receptor signaling pathway
T-helper 1 type immune response
vascular endothelial growth factor receptor signaling pathway - Gene Ontology Molecular Function:
- GTPase activity
GTP binding
protein C-terminus binding - Gene Ontology Cellular Component:
- cytoplasm
cytosol
Golgi apparatus
Golgi membrane
nucleus
perinuclear region of cytoplasm
plasma membrane - Keywords:
- 3D-structure
Acetylation
Alternative splicing
Cell membrane
Complete proteome
Cytoplasm
Direct protein sequencing
Disease mutation
GTP-binding
Golgi apparatus
Lipoprotein
Membrane
Methylation
Nucleotide-binding
Nucleus
Palmitate
Prenylation
Proto-oncogene
Reference proteome
S-nitrosylation - Interacts With:
- Q7Z569; P42337; O00329; O00329-2; Q9Z0S9; P04049; Q12967; Q9EQZ6; Q9NS23-2; Q8WWW0; Q5EBH1; Q5EBH1-2; Q13671; Q07889
Publication
- PubMed ID:
- 6298635 6844927 6087347 14500341 19054851 15489334 6290897 3670300 8393791 3088563 3011420 2661017 8626715 9020151 10369681 10608844 11022048 11598133 11257115 11980706 12684535 15546861 16000296 15705808 17230191 2448879 2476675 2196171 1899707 8142349 9219684 10574788 12213964 12740440 18073111 18596699 1459726 12727991 16170316 16329078 16443854 17054105 17412879 18247425 18039947 19995790 22683711