Drug Miner Browse

Names & Taxonomy

Uniprot ID:: P01112
Entry Name:: RASH_HUMAN
Status:: reviewed
Protein Names:: GTPase HRas (H-Ras-1) (Ha-Ras) (Transforming protein p21) (c-H-ras) (p21ras) [Cleaved into: GTPase HRas, N-terminally processed]
Gene Names:: HRAS HRAS1
Gene Names Primary:: HRAS
Organism:: Homo sapiens (Human)

Structure

Length:: 189
Sequence:: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
Proteomes:: UP000005640

Subcellular location

Subcellular Location:: Cell membrane. Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Golgi apparatus membrane; Lipid-anchor. Note=The active GTP-bound form is localized most strongly to membranes than the inactive GDP-bound form (By similarity). Shuttles between the plasma membrane and the Golgi apparatus.

Function

Function:: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Enzyme Regulation:: ENZYME REGULATION: Alternates between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP).
Gene Ontology Go:: cytoplasm
cytosol
Golgi apparatus
Golgi membrane
nucleus
perinuclear region of cytoplasm
plasma membrane
GTP binding
GTPase activity
protein C-terminus binding
activation of MAPKK activity
axon guidance
blood coagulation
cell cycle arrest
cell proliferation
cell surface receptor signaling pathway
cellular senescence
chemotaxis
defense response to protozoan
endocytosis
ephrin receptor signaling pathway
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
innate immune response
insulin receptor signaling pathway
intrinsic apoptotic signaling pathway
leukocyte migration
MAPK cascade
mitotic cell cycle checkpoint
negative regulation of cell proliferation
negative regulation of gene expression
negative regulation of GTPase activity
negative regulation of neuron apoptotic process
neurotrophin TRK receptor signaling pathway
organ morphogenesis
positive regulation of actin cytoskeleton reorganization
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of DNA replication
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of GTPase activity
positive regulation of interferon-gamma production
positive regulation of JNK cascade
positive regulation of MAP kinase activity
positive regulation of MAPK cascade
positive regulation of miRNA metabolic process
positive regulation of protein phosphorylation
positive regulation of Ras protein signal transduction
positive regulation of ruffle assembly
positive regulation of transcription from RNA polymerase II promoter
positive regulation of wound healing
protein heterooligomerization
Ras protein signal transduction
regulation of long-term neuronal synaptic plasticity
signal transduction
small GTPase mediated signal transduction
social behavior
stimulatory C-type lectin receptor signaling pathway
synaptic transmission
T cell receptor signaling pathway
T-helper 1 type immune response
vascular endothelial growth factor receptor signaling pathway
Gene Ontology Biological Process:: activation of MAPKK activity
axon guidance
blood coagulation
cell cycle arrest
cell proliferation
cell surface receptor signaling pathway
cellular senescence
chemotaxis
defense response to protozoan
endocytosis
ephrin receptor signaling pathway
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
innate immune response
insulin receptor signaling pathway
intrinsic apoptotic signaling pathway
leukocyte migration
MAPK cascade
mitotic cell cycle checkpoint
negative regulation of cell proliferation
negative regulation of gene expression
negative regulation of GTPase activity
negative regulation of neuron apoptotic process
neurotrophin TRK receptor signaling pathway
organ morphogenesis
positive regulation of actin cytoskeleton reorganization
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of DNA replication
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of GTPase activity
positive regulation of interferon-gamma production
positive regulation of JNK cascade
positive regulation of MAPK cascade
positive regulation of MAP kinase activity
positive regulation of miRNA metabolic process
positive regulation of protein phosphorylation
positive regulation of Ras protein signal transduction
positive regulation of ruffle assembly
positive regulation of transcription from RNA polymerase II promoter
positive regulation of wound healing
protein heterooligomerization
Ras protein signal transduction
regulation of long-term neuronal synaptic plasticity
signal transduction
small GTPase mediated signal transduction
social behavior
stimulatory C-type lectin receptor signaling pathway
synaptic transmission
T cell receptor signaling pathway
T-helper 1 type immune response
vascular endothelial growth factor receptor signaling pathway
Gene Ontology Molecular Function:: GTPase activity
GTP binding
protein C-terminus binding
Gene Ontology Cellular Component:: cytoplasm
cytosol
Golgi apparatus
Golgi membrane
nucleus
perinuclear region of cytoplasm
plasma membrane
Keywords:: 3D-structure
Acetylation
Alternative splicing
Cell membrane
Complete proteome
Cytoplasm
Direct protein sequencing
Disease mutation
GTP-binding
Golgi apparatus
Lipoprotein
Membrane
Methylation
Nucleotide-binding
Nucleus
Palmitate
Prenylation
Proto-oncogene
Reference proteome
S-nitrosylation
Interacts With:: Q7Z569; P42337; O00329; O00329-2; Q9Z0S9; P04049; Q12967; Q9EQZ6; Q9NS23-2; Q8WWW0; Q5EBH1; Q5EBH1-2; Q13671; Q07889

Names & Taxonomy

Structure

Subcellular location

Function

Publication