Names & Taxonomy
- Uniprot ID:
- P01009
- Entry Name:
- A1AT_HUMAN
- Status:
- reviewed
- Protein Names:
- Alpha-1-antitrypsin (Alpha-1 protease inhibitor) (Alpha-1-antiproteinase) (Serpin A1) [Cleaved into: Short peptide from AAT (SPAAT)]
- Gene Names:
- SERPINA1 AAT PI PRO0684 PRO2209
- Gene Names Orf:
- PRO0684 PRO2209
- Gene Names Primary:
- SERPINA1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 418
- Sequence:
- MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted. Endoplasmic reticulum. Note=The S and Z allele are not secreted effectively and accumulate intracellularly in the endoplasmic reticulum.; Short peptide from AAT: Secreted, extracellular space, extracellular matrix.
Function
- Function:
- Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.; Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).
- Gene Ontology Go:
- endoplasmic reticulum
endoplasmic reticulum lumen
endoplasmic reticulum-Golgi intermediate compartment membrane
ER to Golgi transport vesicle
extracellular exosome
extracellular region
extracellular space
Golgi apparatus
Golgi membrane
platelet alpha granule lumen
proteinaceous extracellular matrix
glycoprotein binding
identical protein binding
protease binding
serine-type endopeptidase inhibitor activity
acute-phase response
blood coagulation
cellular protein metabolic process
COPII vesicle coating
ER to Golgi vesicle-mediated transport
membrane organization
negative regulation of endopeptidase activity
platelet activation
platelet degranulation
post-translational protein modification
protein N-linked glycosylation via asparagine - Gene Ontology Biological Process:
- acute-phase response
blood coagulation
cellular protein metabolic process
COPII vesicle coating
ER to Golgi vesicle-mediated transport
membrane organization
negative regulation of endopeptidase activity
platelet activation
platelet degranulation
post-translational protein modification
protein N-linked glycosylation via asparagine - Gene Ontology Molecular Function:
- glycoprotein binding
identical protein binding
protease binding
serine-type endopeptidase inhibitor activity - Gene Ontology Cellular Component:
- endoplasmic reticulum
endoplasmic reticulum-Golgi intermediate compartment membrane
endoplasmic reticulum lumen
ER to Golgi transport vesicle
extracellular exosome
extracellular region
extracellular space
Golgi apparatus
Golgi membrane
platelet alpha granule lumen
proteinaceous extracellular matrix - Keywords:
- 3D-structure
Acute phase
Alternative splicing
Blood coagulation
Complete proteome
Direct protein sequencing
Endoplasmic reticulum
Extracellular matrix
Glycoprotein
Hemostasis
Phosphoprotein
Polymorphism
Protease inhibitor
Reference proteome
Secreted
Serine protease inhibitor
Signal - Interacts With:
- Itself; P00760; P00772; P71213; P43307
Publication
- PubMed ID:
- 6319097 6093867 6387509 2985281 3491072 17650587 14702039 15489334 6979715 7045697 1906855 16622833 8323530 3876243 7031661 1406456 3873938 12754519 15084671 14760718 16335952 16263699 19159218 19139490 19838169 21269460 22171320 24275569 26091039 25944712 6332197 2785270 8543039 8756325 8939743 9466920 11057674 10716194 10933492 11178897 12244055 12860985 2669992 1859394 2901226 2394452 2035534 2784123 2786335 1967187 2309708 3262617 8364590 6604220 1905728 2316526 2390072 2339709 2227940 2606478 2254451 7977369 9459000 10651487 10612848 23826168