Names & Taxonomy
- Uniprot ID:
- P00747
- Entry Name:
- PLMN_HUMAN
- Status:
- reviewed
- Protein Names:
- Plasminogen (EC 3.4.21.7) [Cleaved into: Plasmin heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B]
- Gene Names:
- PLG
- Gene Names Primary:
- PLG
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 810
- Sequence:
- MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted
Function
- Function:
- Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.
- Catalytic Activity:
- Preferential cleavage: Lys-|-Xaa > Arg-|-Xaa; higher selectivity than trypsin. Converts fibrin into soluble products.
- Enzyme Regulation:
- ENZYME REGULATION: Converted into plasmin by plasminogen activators, both plasminogen and its activator being bound to fibrin. Activated with catalytic amounts of streptokinase. Plasmin activity inhibited by SERPINE2.
- Active Site:
- ACT_SITE 622 622 Charge relay system.; ACT_SITE 665 665 Charge relay system.; ACT_SITE 760 760 Charge relay system.
- Cross Reference Drug Bank:
- DB00009 DB00513 DB00029 DB06692 DB00015 DB00086 DB00031 DB00302 DB00013
- Gene Ontology Go:
- blood microparticle
cell surface
extracellular exosome
extracellular region
extracellular space
extrinsic component of external side of plasma membrane
plasma membrane
platelet alpha granule lumen
apolipoprotein binding
protein domain specific binding
receptor binding
serine-type endopeptidase activity
serine-type peptidase activity
blood coagulation
cellular protein metabolic process
extracellular matrix disassembly
extracellular matrix organization
fibrinolysis
negative regulation of cell proliferation
negative regulation of cell-cell adhesion mediated by cadherin
negative regulation of cell-substrate adhesion
negative regulation of fibrinolysis
platelet activation
platelet degranulation
positive regulation of fibrinolysis
tissue remodeling - Gene Ontology Biological Process:
- blood coagulation
cellular protein metabolic process
extracellular matrix disassembly
extracellular matrix organization
fibrinolysis
negative regulation of cell-cell adhesion mediated by cadherin
negative regulation of cell proliferation
negative regulation of cell-substrate adhesion
negative regulation of fibrinolysis
platelet activation
platelet degranulation
positive regulation of fibrinolysis
tissue remodeling - Gene Ontology Molecular Function:
- apolipoprotein binding
protein domain specific binding
receptor binding
serine-type endopeptidase activity
serine-type peptidase activity - Gene Ontology Cellular Component:
- blood microparticle
cell surface
extracellular exosome
extracellular region
extracellular space
extrinsic component of external side of plasma membrane
plasma membrane
platelet alpha granule lumen - Keywords:
- 3D-structure
Blood coagulation
Cleavage on pair of basic residues
Complete proteome
Direct protein sequencing
Disease mutation
Disulfide bond
Fibrinolysis
Glycoprotein
Hemostasis
Hydrolase
Kringle
Phosphoprotein
Polymorphism
Protease
Reference proteome
Repeat
Secreted
Serine protease
Signal
Thrombophilia
Tissue remodeling
Zymogen - Interacts With:
- Q6V4L1; Q6V4L4; Q6V4L5; Q6V4L9; P02749; Q99SU7; P00779
Publication
- PubMed ID:
- 2318848 3030813 14574404 15489334 122932 6148961 126863 142009 4694729 4240117 6919539 6094526 9201958 3356193 9102401 9054441 7525077 9102221 9548733 10077593 10889192 14699093 16043488 18780401 2143188 19712047 24275569 1657148 1657149 8054447 8611560 15299951 9783753 9521645 10656799 11350170 12054798 12456874 15211511 23335990 2157850 8181475 8181476 8652577 9305949 1986355 8392398 6216475 6238949 1427790 9242524 9858247 10233898