Names & Taxonomy
- Uniprot ID:
- O94788
- Entry Name:
- AL1A2_HUMAN
- Status:
- reviewed
- Protein Names:
- Retinal dehydrogenase 2 (RALDH 2) (RalDH2) (EC 1.2.1.36) (Aldehyde dehydrogenase family 1 member A2) (Retinaldehyde-specific dehydrogenase type 2) (RALDH(II))
- Gene Names:
- ALDH1A2 RALDH2
- Gene Names Primary:
- ALDH1A2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 518
- Sequence:
- MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm.
Function
- Function:
- Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently (By similarity).
- Pathway:
- Cofactor metabolism; retinol metabolism.
- Catalytic Activity:
- Retinal + NAD(+) + H(2)O = retinoate + NADH.
- Active Site:
- ACT_SITE 286 286 Proton acceptor.
- Cross Reference Drug Bank:
- DB00755 DB00162
- Gene Ontology Go:
- cytoplasm
cytosol
perinuclear region of cytoplasm
3-chloroallyl aldehyde dehydrogenase activity
aldehyde dehydrogenase (NAD) activity
retinal binding
retinal dehydrogenase activity
9-cis-retinoic acid biosynthetic process
anterior/posterior pattern specification
blood vessel development
cardiac muscle tissue development
cellular response to retinoic acid
determination of bilateral symmetry
embryonic camera-type eye development
embryonic digestive tract development
embryonic forelimb morphogenesis
face development
heart morphogenesis
hindbrain development
kidney development
liver development
lung development
midgut development
morphogenesis of embryonic epithelium
negative regulation of cell proliferation
neural crest cell development
neural tube development
neuron differentiation
pancreas development
pituitary gland development
positive regulation of apoptotic process
positive regulation of cell proliferation
positive regulation of gene expression
proximal/distal pattern formation
regulation of endothelial cell proliferation
response to cytokine
response to estradiol
response to vitamin A
retinal metabolic process
retinoic acid metabolic process
retinoic acid receptor signaling pathway
retinol metabolic process
ureter maturation
vitamin A metabolic process - Gene Ontology Biological Process:
- 9-cis-retinoic acid biosynthetic process
anterior/posterior pattern specification
blood vessel development
cardiac muscle tissue development
cellular response to retinoic acid
determination of bilateral symmetry
embryonic camera-type eye development
embryonic digestive tract development
embryonic forelimb morphogenesis
face development
heart morphogenesis
hindbrain development
kidney development
liver development
lung development
midgut development
morphogenesis of embryonic epithelium
negative regulation of cell proliferation
neural crest cell development
neural tube development
neuron differentiation
pancreas development
pituitary gland development
positive regulation of apoptotic process
positive regulation of cell proliferation
positive regulation of gene expression
proximal/distal pattern formation
regulation of endothelial cell proliferation
response to cytokine
response to estradiol
response to vitamin A
retinal metabolic process
retinoic acid metabolic process
retinoic acid receptor signaling pathway
retinol metabolic process
ureter maturation
vitamin A metabolic process - Gene Ontology Molecular Function:
- 3-chloroallyl aldehyde dehydrogenase activity
aldehyde dehydrogenase (NAD) activity
retinal binding
retinal dehydrogenase activity - Gene Ontology Cellular Component:
- cytoplasm
cytosol
perinuclear region of cytoplasm - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Cytoplasm
NAD
Oxidoreductase
Polymorphism
Reference proteome