Names & Taxonomy
- Uniprot ID:
- O75469
- Entry Name:
- NR1I2_HUMAN
- Status:
- reviewed
- Protein Names:
- Nuclear receptor subfamily 1 group I member 2 (Orphan nuclear receptor PAR1) (Orphan nuclear receptor PXR) (Pregnane X receptor) (Steroid and xenobiotic receptor) (SXR)
- Gene Names:
- NR1I2 PXR
- Gene Names Primary:
- NR1I2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 434
- Sequence:
- MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus
Function
- Function:
- Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
- Cross Reference Drug Bank:
- DB01248 DB00530 DB00783 DB00977 DB01229 DB01045 DB01220 DB08864 DB00163
- Gene Ontology Go:
- nucleoplasm
drug binding
RNA polymerase II regulatory region sequence-specific DNA binding
RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding
steroid hormone receptor activity
transcription coactivator activity
transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
zinc ion binding
drug export
exogenous drug catabolic process
gene expression
intracellular receptor signaling pathway
negative regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription, DNA-templated
signal transduction
steroid metabolic process
transcription initiation from RNA polymerase II promoter
xenobiotic metabolic process
xenobiotic transport - Gene Ontology Biological Process:
- drug export
exogenous drug catabolic process
gene expression
intracellular receptor signaling pathway
negative regulation of transcription, DNA-templated
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
signal transduction
steroid metabolic process
transcription initiation from RNA polymerase II promoter
xenobiotic metabolic process
xenobiotic transport - Gene Ontology Molecular Function:
- drug binding
RNA polymerase II regulatory region sequence-specific DNA binding
RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding
steroid hormone receptor activity
transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
transcription coactivator activity
zinc ion binding - Gene Ontology Cellular Component:
- nucleoplasm
- Keywords:
- 3D-structure
Activator
Alternative splicing
Complete proteome
DNA-binding
Metal-binding
Nucleus
Polymorphism
Receptor
Reference proteome
Transcription
Transcription regulation
Zinc
Zinc-finger - Interacts With:
- P08238